Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RCI2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05880 71 / 2e-18 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 66 / 8e-17 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT2G38905 66 / 1e-16 Low temperature and salt responsive protein family (.1) AT1G57550 57 / 6e-13 Low temperature and salt responsive protein family (.1) AT4G30650 48 / 2e-09 Low temperature and salt responsive protein family (.1) AT4G30660 46 / 1e-08 Low temperature and salt responsive protein family (.1.2) AT2G24040 45 / 4e-08 Low temperature and salt responsive protein family (.1) AT4G28088 45 / 4e-08 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002100 [exp] 69 / 9e-18 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.008G044300 [exp] 65 / 2e-16 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 65 / 2e-16 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 65 / 3e-16 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 49 / 6e-10 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 46 / 2e-08 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029449 [exp] 67 / 3e-17 ND 89 / 1e-25 Lus10014028 [exp] 66 / 1e-16 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10040370 [exp] 66 / 1e-16 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 66 / 1e-16 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10005948 [exp] 67 / 2e-16 ND 85 / 5e-23 Lus10019890 [exp] 66 / 2e-16 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10029450 [exp] 65 / 3e-16 ND 87 / 6e-25 Lus10036592 [exp] 45 / 4e-08 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10035809 [exp] 45 / 4e-08 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [poplar] [flax] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Potri.013G001600.2 pacid=42811785 polypeptide=Potri.013G001600.2.p locus=Potri.013G001600 ID=Potri.013G001600.2.v4.1 annot-version=v4.1 ATGTCAAGTACTAACTTCATAGACATCTTGCTGGCCATCATCTTGCCTCCTCTCGGTGTATTCCTCAAGTTTGGTTGCGGGGCGGAGTTTTGGATCTGCT TGCTGCTTACCATTTTAGGGTACATCCCTGGAATCATTTATGCCGTCTATATCATTACCAAGTGA
AA sequence Show only first row Show all	>Potri.013G001600.2 pacid=42811785 polypeptide=Potri.013G001600.2.p locus=Potri.013G001600 ID=Potri.013G001600.2.v4.1 annot-version=v4.1 MSSTNFIDILLAIILPPLGVFLKFGCGAEFWICLLLTILGYIPGIIYAVYIITK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Potri.013G001600 [exp]	0	1	Pt-RCI2.1
AT5G13770			Pentatricopeptide repeat (PPR-...		Potri.008G142900 [exp]	2.82	0.9671
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Potri.015G022100 [exp]	3.46	0.9577
AT5G14570		ATNRT2.7	high affinity nitrate transpor...		Potri.001G348300 [exp]	5.65	0.9525
AT3G52740			unknown protein		Potri.004G203000 [exp]	8.48	0.9562
AT1G51920			unknown protein		Potri.001G172850 [exp]	10.67	0.9393
AT5G24120		ATSIG5, SIG5, S...	SIGMA FACTOR 5, sigma factor E...		Potri.012G031100 [exp]	11.18	0.9521	Pt-SIGE.3
AT5G19875			unknown protein		Potri.001G231300 [exp]	11.22	0.9510
AT5G62680			Major facilitator superfamily ...		Potri.001G351200 [exp]	11.22	0.9396
AT5G22090			Protein of unknown function (D...		Potri.009G016600 [exp]	11.83	0.9295
AT1G79160			unknown protein		Potri.011G153600 [exp]	13.41	0.9448

Compare expression of checked genes

Potri.013G001600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.