Pt-XTH3.1 (Potri.013G005700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-XTH3.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25810 431 / 5e-153 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 419 / 1e-148 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57550 399 / 2e-140 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 396 / 9e-140 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 377 / 7e-132 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT2G18800 376 / 3e-131 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT5G57540 375 / 4e-131 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT4G14130 375 / 4e-131 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 374 / 1e-130 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G48070 369 / 7e-129 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G007200 466 / 6e-167 AT4G25810 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 459 / 3e-164 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 459 / 4e-164 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G071200 426 / 4e-151 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094800 424 / 3e-150 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094900 413 / 7e-146 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.002G060500 411 / 3e-145 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 407 / 9e-144 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 404 / 2e-142 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030484 389 / 2e-136 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Lus10000678 385 / 4e-135 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 385 / 5e-135 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10008522 381 / 3e-133 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 380 / 4e-133 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10004723 378 / 6e-132 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 374 / 1e-130 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 373 / 3e-130 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010939 372 / 7e-130 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 370 / 3e-129 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Potri.013G005700.1 pacid=42812255 polypeptide=Potri.013G005700.1.p locus=Potri.013G005700 ID=Potri.013G005700.1.v4.1 annot-version=v4.1
ATGCACAACTCATCAGTTACCAAAACTCGTACTATAAATTCCCACCAAGACATGCACAATACACATCTCCTCACTTCCAAACAACTTGCTAAACTGCATT
TCATTGTATCCATGGCTTTTCTGCTTGCTTCTTCAAGTGTTCCGATGTTATTAATGTTCTTGGTCTCTTTTACAGTCAGTTCTTTGATGGGGTCATCTCT
TGGTAACTTCTACCAAAACTTTGATATTACATGGGGAGATGGCCGTGCTAAGATACTCAACAATGGTGAGCTTCTTACTCTCAATCTTGACAAAGCTTCT
GGCTCAGGATTCCAATCCAAGAACGAGTATTTATTTGGAAAGATTGATATGCAACTCAAGCTTGTCCCTGGCAACTCCGCTGGCACTGTAACTGCCTATT
ATTTGTCATCAAAAGGGTCAACATGGGATGAGATAGACTTCGAGTTCTTGGGGAACTTGAGTGGCGATCCTTACATTCTCCATACCAATGTGTTTAGCCA
AGGCAAAGGCAACAGGGAGCAACAATTTTACCTCTGGTTTGATCCAACTACTGATTTCCACACCTACTCCATCCTCTGGAACCCACAAAGAATCATTTTC
TCTGTAGATGGCACCCCTATTAGAGAATTCAAGAACATGGAATCAAGAGGTGTTCCATTCCCAAAGAATCAGCCAATGAGAATTTACTCTAGTTTATGGA
ATGCAGATGACTGGGCTACAAGAGGTGGCTTAGTGAAGACTGATTGGTCAAAAGCTCCTTTCACTGCTTCTTATAAGAACTTCAATGCTAAGGATGCTTG
TGTCTGGTCCAATGGTGCATCTTCTTGTGGTACAAATTCCTCTGCTGCTGCAGCCTCCTCCACCACCAACGCTTGGCTTTCAGAAGAGCTTGGTTCAACA
AGTCAAGAGAGGCTAGAATGGGTCAAAAAAAACTACATGATATACAATTACTGCACAGACGCTAAGAGGTTTCCTCAAGGACTTCCTCCAGAATGCAGCG
CTTCTTAA
AA sequence
>Potri.013G005700.1 pacid=42812255 polypeptide=Potri.013G005700.1.p locus=Potri.013G005700 ID=Potri.013G005700.1.v4.1 annot-version=v4.1
MHNSSVTKTRTINSHQDMHNTHLLTSKQLAKLHFIVSMAFLLASSSVPMLLMFLVSFTVSSLMGSSLGNFYQNFDITWGDGRAKILNNGELLTLNLDKAS
GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYYLSSKGSTWDEIDFEFLGNLSGDPYILHTNVFSQGKGNREQQFYLWFDPTTDFHTYSILWNPQRIIF
SVDGTPIREFKNMESRGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTASYKNFNAKDACVWSNGASSCGTNSSAAAASSTTNAWLSEELGST
SQERLEWVKKNYMIYNYCTDAKRFPQGLPPECSAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.013G005700 0 1 Pt-XTH3.1
AT4G16120 ATSEB1, COBL7 ARABIDOPSIS THALIANA SEC61 BET... Potri.010G001100 1.00 0.8857 ATSEB1.1
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Potri.018G100400 2.82 0.8397 GAE1.1
AT3G24630 unknown protein Potri.018G082300 3.16 0.8733
AT5G11070 unknown protein Potri.006G259200 4.58 0.8670
AT5G38700 unknown protein Potri.002G198800 5.29 0.8467
AT4G08950 EXO EXORDIUM, Phosphate-responsive... Potri.002G098600 6.32 0.8346
AT1G47380 Protein phosphatase 2C family ... Potri.002G127300 6.40 0.7304
AT4G07960 ATCSLC12 CELLULOSE-SYNTHASE LIKE C12, C... Potri.005G146900 7.41 0.8570
AT3G17675 Cupredoxin superfamily protein... Potri.013G030000 8.24 0.7467
AT5G54380 THE1 THESEUS1, protein kinase famil... Potri.011G128000 9.53 0.8103

Potri.013G005700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.