Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56600 363 / 4e-127 ATGOLS2 galactinol synthase 2 (.1) AT2G47180 352 / 2e-122 ATGOLS1 galactinol synthase 1 (.1) AT1G09350 333 / 1e-115 ATGOLS3 galactinol synthase 3 (.1) AT4G26250 327 / 8e-113 ATGOLS6 galactinol synthase 6 (.1) AT5G30500 324 / 9e-112 GolS10 galactinol synthase 10, Nucleotide-diphospho-sugar transferases superfamily protein (.1) AT1G60470 320 / 2e-110 ATGOLS4 galactinol synthase 4 (.1) AT5G23790 315 / 3e-108 ATGOLS5 galactinol synthase 5 (.1) AT1G60450 299 / 6e-102 ATGOLS7 galactinol synthase 7 (.1) AT1G77130 73 / 1e-14 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) AT3G18660 72 / 3e-14 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G005800 [exp] 435 / 2e-155 AT1G56600 543 / 0.0 galactinol synthase 2 (.1) Potri.005G006800 [exp] 427 / 2e-152 AT1G56600 539 / 0.0 galactinol synthase 2 (.1) Potri.014G116800 [exp] 365 / 1e-127 AT2G47180 568 / 0.0 galactinol synthase 1 (.1) Potri.002G191600 [exp] 357 / 1e-124 AT2G47180 565 / 0.0 galactinol synthase 1 (.1) Potri.010G150400 [exp] 349 / 1e-121 AT2G47180 519 / 0.0 galactinol synthase 1 (.1) Potri.008G101000 [exp] 343 / 2e-119 AT2G47180 507 / 0.0 galactinol synthase 1 (.1) Potri.010G042000 [exp] 334 / 9e-116 AT1G60470 534 / 0.0 galactinol synthase 4 (.1) Potri.008G189400 [exp] 334 / 1e-115 AT1G60470 545 / 0.0 galactinol synthase 4 (.1) Potri.005G187900 [exp] 72 / 2e-14 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031434 [exp] 356 / 3e-124 AT2G47180 543 / 0.0 galactinol synthase 1 (.1) Lus10010897 [exp] 352 / 1e-122 AT2G47180 533 / 0.0 galactinol synthase 1 (.1) Lus10029145 [exp] 315 / 9e-108 AT2G47180 493 / 1e-176 galactinol synthase 1 (.1) Lus10013020 [exp] 250 / 4e-82 AT2G47180 336 / 3e-114 galactinol synthase 1 (.1) Lus10018922 [exp] 73 / 2e-14 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Lus10028623 [exp] 72 / 2e-14 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1) Lus10033485 [exp] 69 / 3e-13 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Lus10020890 [exp] 69 / 3e-13 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3) Lus10021731 [exp] 66 / 4e-12 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2) Lus10042658 [exp] 65 / 6e-12 AT4G33330 801 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0110 [poplar] [flax] GT-A PF01501 [poplar] [flax] Glyco_transf_8 Glycosyl transferase family 8
Representative CDS sequence Show only first row Show all	>Potri.013G005900.4 pacid=42811104 polypeptide=Potri.013G005900.4.p locus=Potri.013G005900 ID=Potri.013G005900.4.v4.1 annot-version=v4.1 ATGGCTCCTCATATTACAACTGCCCTTGCTAACAGCACAAACTCTCTAGTCAAGCAAGCTAGCTTGTCGAGCTGTGCATATGTTACCTTTTTGGCTGGTG ATGGAGACTACTGGAAGGGTGTTGTGGGGTTAGCCAAGGGGCTGAGGAAGGCCAAGAGCAAGTATCCTTTGGTGGTGGCTATCTTGCCTGATGTTCCTGA GGAGCATCGGATGATACTTGTCTCTCAAGGGTGTATAGTGAGGGAGATTGAGCCTGTTCATCCACCGGAGAACCAGACTCGGTTTGCTATGCCTTATTAT GTCATCAACTACTCCAAACTTCGTATCTGGGAGTTTGTTGAGTATAGCAAAATGATATATTTGGACGGGGACATCCAGGTATTTGACAACATAGACCACC TGTTCGACATGCCTGATGGTTACTTCTATGCTGTGATGGACTGTTTCTGTGAGAAAACATGGAGCGACAGCCCTCAGTACAAGATTGGTTACTGCCAACA GTGTCCTGATAAGGTCCAGTGGCCTGCTGAGATGGGTCCTAAGCCCCCTCTGTACTTCAATGCTGGCATGTTTGTTTATGAGCCCAACTTGTCCACTTAT CATGATCTGTTGGAGACCGTCAAAGTCACCTCCCCCACCCTCTTCGCTGAGCAGGGATGTTTACAAGCCAATTCCTTCGGATTACAACCTTGTACTGGCC ATGTTATGGCGCCATCCTGA
AA sequence Show only first row Show all	>Potri.013G005900.4 pacid=42811104 polypeptide=Potri.013G005900.4.p locus=Potri.013G005900 ID=Potri.013G005900.4.v4.1 annot-version=v4.1 MAPHITTALANSTNSLVKQASLSSCAYVTFLAGDGDYWKGVVGLAKGLRKAKSKYPLVVAILPDVPEEHRMILVSQGCIVREIEPVHPPENQTRFAMPYY VINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDMPDGYFYAVMDCFCEKTWSDSPQYKIGYCQQCPDKVQWPAEMGPKPPLYFNAGMFVYEPNLSTY HDLLETVKVTSPTLFAEQGCLQANSFGLQPCTGHVMAPS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G56600		ATGOLS2	galactinol synthase 2 (.1)		Potri.013G005900 [exp]	0	1
AT3G56290			unknown protein		Potri.019G056400 [exp]	4.35	0.9638
AT5G50210		SUFE3, OLD5, QS	SULFUR E 3, ONSET OF LEAF DEAT...		Potri.015G085300 [exp]	4.89	0.9636
					Potri.019G015700 [exp]	6.48	0.9600
AT1G20440		AtCOR47, RD17, ...	cold-regulated 47 (.1)		Potri.002G013200 [exp]	7.41	0.9571
AT4G21990		3-Apr, PRH-26, ...	PAPS REDUCTASE HOMOLOG 26, APS...		Potri.004G011525 [exp]	9.00	0.9589
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.006G172100 [exp]	9.21	0.9612
AT3G17860	ZIM	TIFY6B, JAI3, J...	JASMONATE-INSENSITIVE 3, jasmo...		Potri.012G044900 [exp]	9.53	0.9535
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.006G174202 [exp]	10.09	0.9607
					Potri.018G001950 [exp]	11.18	0.9370
AT4G10270			Wound-responsive family protei...		Potri.001G408100 [exp]	12.40	0.9532

Compare expression of checked genes

Potri.013G005900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.