Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08510 85 / 4e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G14820 77 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G28690 76 / 8e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G26900 75 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21300 73 / 5e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G56310 73 / 7e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09190 73 / 7e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G15930 72 / 1e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G74630 72 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G20230 72 / 1e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G019400 [exp] 114 / 6e-32 AT1G09190 574 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G223900 [exp] 81 / 7e-20 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G322100 [exp] 80 / 3e-19 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G175900 [exp] 79 / 3e-19 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G054000 [exp] 77 / 2e-18 AT1G28690 672 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G243800 [exp] 77 / 2e-18 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G080200 [exp] 76 / 9e-18 AT1G11290 447 / 3e-145 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G011000 [exp] 75 / 1e-17 AT1G08070 572 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G241100 [exp] 75 / 2e-17 AT5G04780 572 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029853 [exp] 95 / 9e-25 AT1G09190 575 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015308 [exp] 79 / 6e-19 AT1G28690 632 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030225 [exp] 78 / 1e-18 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10025420 [exp] 77 / 2e-18 AT1G28690 634 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030053 [exp] 77 / 4e-18 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005638 [exp] 75 / 5e-18 AT5G40410 305 / 9e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005987 [exp] 76 / 6e-18 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014298 [exp] 76 / 7e-18 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10016511 [exp] 76 / 8e-18 AT5G59600 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026006 [exp] 75 / 1e-17 AT5G66520 746 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.013G010150.1 pacid=42812235 polypeptide=Potri.013G010150.1.p locus=Potri.013G010150 ID=Potri.013G010150.1.v4.1 annot-version=v4.1 ATGGTGAAACACCATCAAATTAAGCCAAAAGTTGAACACTATGGATGCATGGTTGATCTGCTTGGGCGTGCTGGATGTGTGAGGGAGGCTTATGATCTGC TTAGAAGCATGCCTGAGGGAACTCCAAATGATGCTGCTCCATGGGGTTCCTTGCTTAGTGCTTGCCATACTCATGGCGACGTAGAGCTTACACACATCTT GCAGTGA
AA sequence Show only first row Show all	>Potri.013G010150.1 pacid=42812235 polypeptide=Potri.013G010150.1.p locus=Potri.013G010150 ID=Potri.013G010150.1.v4.1 annot-version=v4.1 MVKHHQIKPKVEHYGCMVDLLGRAGCVREAYDLLRSMPEGTPNDAAPWGSLLSACHTHGDVELTHILQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G08510			Pentatricopeptide repeat (PPR)...		Potri.013G010150 [exp]	0	1
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G045100 [exp]	2.82	0.9468
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G044900 [exp]	3.46	0.9355
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G045300 [exp]	4.00	0.9322
AT2G17570			Undecaprenyl pyrophosphate syn...		Potri.002G039400 [exp]	9.48	0.8791
					Potri.002G034250 [exp]	12.00	0.7722
AT3G51895		AST12, ATST1, S...	sulfate transporter 3;1 (.1)		Potri.010G082700 [exp]	12.32	0.8185
AT4G02810		FAF1	FANTASTIC FOUR 1, Protein of u...		Potri.002G053400 [exp]	14.07	0.8625
					Potri.001G282604 [exp]	14.14	0.8625
AT5G53420			CCT motif family protein (.1.2...		Potri.015G014000 [exp]	14.28	0.8198
					Potri.002G239451 [exp]	16.61	0.8458

Compare expression of checked genes

Potri.013G010150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.