Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05700 250 / 1e-84 Drought-responsive family protein (.1) AT5G26990 238 / 1e-79 Drought-responsive family protein (.1) AT1G56280 183 / 2e-58 ATDI19 drought-induced 19 (.1.2) AT5G49230 176 / 2e-55 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) AT3G06760 172 / 5e-54 Drought-responsive family protein (.1.2) AT4G02200 111 / 3e-30 Drought-responsive family protein (.1.2.3) AT1G02750 109 / 2e-29 Drought-responsive family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G020900 [exp] 368 / 2e-131 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1) Potri.010G000800 [exp] 244 / 3e-82 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.008G213400 [exp] 231 / 5e-77 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.002G200500 [exp] 163 / 3e-50 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1) Potri.014G125500 [exp] 160 / 4e-49 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1) Potri.011G057200 [exp] 125 / 2e-35 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2) Potri.019G027300 [exp] 105 / 2e-29 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.012G086500 [exp] 91 / 2e-22 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031467 [exp] 310 / 4e-108 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1) Lus10015214 [exp] 247 / 9e-84 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1) Lus10037819 [exp] 184 / 1e-58 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10013420 [exp] 141 / 7e-42 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2) Lus10001462 [exp] 140 / 2e-41 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1) Lus10017097 [exp] 127 / 1e-36 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10010305 [exp] 126 / 6e-36 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2) Lus10015412 [exp] 123 / 1e-34 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1) Lus10037717 [exp] 122 / 8e-32 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1) Lus10002441 [exp] 88 / 3e-22 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [poplar] [flax] C2H2-zf PF05605 [poplar] [flax] zf-Di19 Drought induced 19 protein (Di19), zinc-binding CL0361 [poplar] [flax] PF14571 [poplar] [flax] Di19_C Stress-induced protein Di19, C-terminal
Representative CDS sequence Show only first row Show all	>Potri.013G011200.1 pacid=42810811 polypeptide=Potri.013G011200.1.p locus=Potri.013G011200 ID=Potri.013G011200.1.v4.1 annot-version=v4.1 ATGGATGCTGATTCATGGAGTGCTCGTCTTTCTTCAGCTTCTAAGAGATACCAATCAGCTCTTCAATCACGATCTGATATGTTTATGGGGTTTGAAGAAA TTGATGGAGATGATGATATAAGGGAGGAGTTTCCATGCCCATTCTGTTCCGAATATTTTGATATTGTTGGGCTGTGTTGTCACATTGATGATGAGCATCC TGTTGAATCAAAGAATGGGGTTTGCCCAGTTTGTGCAATGAGGGTGGGTGTTGACATGGTTGCACATATAACGCTACAACATGGAAATATATTCAAGATG CAGCGCAAGAGGAAATCACGTAGAGGTGGACCTCATTCAACCCTTTCTTTGTTGAGGAAAGAACTGCGAGAAGGAAATCTACAATCCCTTCTTGGCGGTT CGTCCTGTATAGTTTCCTCATCCAATGCAGCACCTGATCCATTATTATCTTCATTCATTTTACCCATGGTTGATGATTTCACGAGTTCCCAGCCTTCCTT TTTGTCTGAAACAAGTTCAGCTAAGAAAGGCACGGATGGGAATGTCTCAGAACGAAATAGGAAGTCACCTCCAATGTCAATTAAGGATAAGGAAGAGAAG GCCAAAAGGAGTGAGTTTGTACAAGGGCTGTTGTTGTCTACAATTCCTGATGACATTTTATAG
AA sequence Show only first row Show all	>Potri.013G011200.1 pacid=42810811 polypeptide=Potri.013G011200.1.p locus=Potri.013G011200 ID=Potri.013G011200.1.v4.1 annot-version=v4.1 MDADSWSARLSSASKRYQSALQSRSDMFMGFEEIDGDDDIREEFPCPFCSEYFDIVGLCCHIDDEHPVESKNGVCPVCAMRVGVDMVAHITLQHGNIFKM QRKRKSRRGGPHSTLSLLRKELREGNLQSLLGGSSCIVSSSNAAPDPLLSSFILPMVDDFTSSQPSFLSETSSAKKGTDGNVSERNRKSPPMSIKDKEEK AKRSEFVQGLLLSTIPDDIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05700			Drought-responsive family prot...		Potri.013G011200 [exp]	0	1
AT3G16640		TCTP	translationally controlled tum...		Potri.010G013400 [exp]	1.41	0.9138	Pt-TCTP.2
AT5G46030			unknown protein		Potri.011G097300 [exp]	1.41	0.9273
AT5G06240		EMB2735	embryo defective 2735 (.1)		Potri.016G074700 [exp]	1.73	0.9016
AT5G08170		ATAIH, EMB1873	EMBRYO DEFECTIVE 1873, AGMATIN...		Potri.015G055300 [exp]	2.00	0.8947
AT3G59800			unknown protein		Potri.017G010100 [exp]	4.24	0.8539
AT1G20950			Phosphofructokinase family pro...		Potri.006G024500 [exp]	6.48	0.8634
AT3G56680			Single-stranded nucleic acid b...		Potri.016G032500 [exp]	6.92	0.8467
AT1G02780		EMB2386	embryo defective 2386, Ribosom...		Potri.004G078000 [exp]	7.93	0.8329	Pt-RPL19.3
AT3G15140			Polynucleotidyl transferase, r...		Potri.001G030900 [exp]	8.48	0.7739
AT1G45976		SBP1	S-ribonuclease binding protein...		Potri.002G124700 [exp]	8.71	0.8346

Compare expression of checked genes

Potri.013G011200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.