Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09155 120 / 1e-33 ATPP2-B15 phloem protein 2-B15 (.1) AT2G02360 108 / 3e-29 ATPP2-B10 phloem protein 2-B10 (.1) AT1G56240 105 / 5e-28 ATPP2-B13 phloem protein 2-B13 (.1) AT5G24560 98 / 2e-25 ATPP2-B12 phloem protein 2-B12 (.1) AT1G56250 96 / 3e-24 ATPP2-B14 phloem protein 2-B14 (.1) AT1G80110 92 / 4e-23 ATPP2-B11 phloem protein 2-B11 (.1) AT2G02340 89 / 3e-21 ATPP2-B8 phloem protein 2-B8 (.1) AT2G02240 85 / 5e-20 MEE66 maternal effect embryo arrest 66, F-box family protein (.1) AT2G02230 85 / 8e-20 ATPP2-B1 phloem protein 2-B1 (.1) AT2G02320 78 / 2e-17 ATPP2-B7 phloem protein 2-B7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G022000 [exp] 145 / 4e-43 AT1G09155 290 / 4e-98 phloem protein 2-B15 (.1) Potri.013G012600 [exp] 141 / 1e-41 AT1G09155 281 / 1e-94 phloem protein 2-B15 (.1) Potri.018G015800 [exp] 120 / 3e-33 AT2G02240 242 / 1e-78 maternal effect embryo arrest 66, F-box family protein (.1) Potri.018G016100 [exp] 110 / 1e-29 AT2G02250 217 / 2e-69 phloem protein 2-B2 (.1) Potri.006G267000 [exp] 108 / 7e-29 AT2G02240 239 / 1e-77 maternal effect embryo arrest 66, F-box family protein (.1) Potri.001G050100 [exp] 105 / 4e-28 AT2G02360 219 / 5e-71 phloem protein 2-B10 (.1) Potri.006G266900 [exp] 106 / 5e-28 AT2G02240 215 / 2e-68 maternal effect embryo arrest 66, F-box family protein (.1) Potri.018G016000 [exp] 106 / 5e-28 AT2G02250 220 / 2e-70 phloem protein 2-B2 (.1) Potri.012G120400 [exp] 71 / 4e-15 AT4G19840 233 / 1e-76 phloem protein 2-A1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020674 [exp] 141 / 1e-41 AT1G09155 266 / 7e-89 phloem protein 2-B15 (.1) Lus10015208 [exp] 140 / 4e-41 AT1G09155 270 / 2e-90 phloem protein 2-B15 (.1) Lus10020673 [exp] 135 / 2e-39 AT1G09155 272 / 2e-91 phloem protein 2-B15 (.1) Lus10029872 [exp] 133 / 2e-38 AT1G09155 272 / 3e-91 phloem protein 2-B15 (.1) Lus10031484 [exp] 129 / 1e-36 AT1G09155 260 / 1e-85 phloem protein 2-B15 (.1) Lus10031473 [exp] 118 / 4e-33 AT1G09155 228 / 1e-74 phloem protein 2-B15 (.1) Lus10042713 [exp] 115 / 2e-31 AT2G02230 235 / 1e-75 phloem protein 2-B1 (.1) Lus10029674 [exp] 114 / 5e-31 AT2G02230 237 / 2e-76 phloem protein 2-B1 (.1) Lus10018171 [exp] 107 / 5e-28 AT2G02240 219 / 2e-69 maternal effect embryo arrest 66, F-box family protein (.1) Lus10015209 [exp] 103 / 2e-27 AT1G09155 209 / 1e-66 phloem protein 2-B15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF14299 [poplar] [flax] PP2 Phloem protein 2
Representative CDS sequence Show only first row Show all	>Potri.013G012666.1 pacid=42811608 polypeptide=Potri.013G012666.1.p locus=Potri.013G012666 ID=Potri.013G012666.1.v4.1 annot-version=v4.1 ATGGTTGGAAAAATCTCATTGGAAAATTCAACAGGTAAGAAATGCTACATTTTGAGTGAAAGGGAGCTTTCAATTACGTGGGCTAACAATTCTCTCTACT GCTCCTGGAAACCCCACAGCCAGTCAACAATTTGTTGGTTACAAATCCATGGCAAAATCAATACCGAGATGCTATCTCCAAAAACAATTTATGGGGCCTA TCTCATGGTTAAATTTGCTGGTCGAGCTTATGGATTAGACACTCTACAATCACAAATATCAGAAGAAGGTGGCAACTTCAAATCAGTAGGCAAGGTTTAT TTACGCCGGCGCCAAGACAAAAATAAACAAGCTTGTCTCTTGAAAGGAAGTAATTACCTTCAAGAACGTGAAGATGAATGTATTGAGATTGAATTGGGGA GTTTTTACAATGATGGGGGTGATGCTAAGGAAGTGGAGATGTGCCGAAAAGAGGTGCCTGGTGAGCATTTGAAAGGTGGGCTTATTGTTGAAGGAATTGA GCTTAGGCCTAAGAAAATGATGAAGGTTTGA
AA sequence Show only first row Show all	>Potri.013G012666.1 pacid=42811608 polypeptide=Potri.013G012666.1.p locus=Potri.013G012666 ID=Potri.013G012666.1.v4.1 annot-version=v4.1 MVGKISLENSTGKKCYILSERELSITWANNSLYCSWKPHSQSTICWLQIHGKINTEMLSPKTIYGAYLMVKFAGRAYGLDTLQSQISEEGGNFKSVGKVY LRRRQDKNKQACLLKGSNYLQEREDECIEIELGSFYNDGGDAKEVEMCRKEVPGEHLKGGLIVEGIELRPKKMMKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Potri.013G012666 [exp]	0	1
AT3G56180			Protein of unknown function (D...		Potri.008G075100 [exp]	3.16	0.9743
AT1G24400		ATLHT2, AATL2, ...	ARABIDOPSIS LYSINE HISTIDINE T...		Potri.008G179000 [exp]	4.89	0.9558
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.001G256600 [exp]	5.47	0.9505
AT5G53540			P-loop containing nucleoside t...		Potri.012G022985 [exp]	7.00	0.9352
					Potri.006G228650 [exp]	15.81	0.8757
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Potri.002G244200 [exp]	15.87	0.8751	Pt-XTH2.1
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.006G001600 [exp]	16.43	0.8691
					Potri.012G134051 [exp]	17.32	0.8757
AT1G78720			SecY protein transport family ...		Potri.011G114900 [exp]	21.79	0.8757
AT4G02550			unknown protein		Potri.011G088750 [exp]	21.90	0.7141

Compare expression of checked genes

Potri.013G012666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.