Potri.013G012733 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012800 247 / 9e-85 ND /
Potri.013G012766 233 / 3e-79 ND /
Potri.005G022200 211 / 1e-70 ND /
Potri.005G022250 155 / 3e-48 ND /
Potri.005G195200 151 / 8e-47 AT5G64620 42 / 7e-05 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G022300 150 / 1e-46 ND /
Potri.005G022400 149 / 3e-46 ND /
Potri.001G073350 114 / 1e-32 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007598 75 / 1e-16 ND 42 / 2e-04
Lus10027768 73 / 3e-16 ND /
Lus10000961 72 / 6e-16 ND 39 / 5e-04
Lus10040145 72 / 1e-15 ND 40 / 4e-04
Lus10035527 68 / 3e-14 AT4G24640 40 / 4e-04 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10011019 57 / 1e-09 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
Lus10003530 40 / 0.0003 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.013G012733.1 pacid=42810827 polypeptide=Potri.013G012733.1.p locus=Potri.013G012733 ID=Potri.013G012733.1.v4.1 annot-version=v4.1
ATGGGTTCCAAGAATCGCATCATGATTTTTGCTGCCATTGTCTTGCATCTCTTCCTGCATTTTCCTTCTCAAACAGAGGCAGGAGCGGAATTAGTGAGTA
AGGTCTGCAAACAAAGCCAAGACTACCAGTCCTGCGTTCAAATCCTGACGTCCCATCCACAAACTTTGTCAGCATCTGAAAAAAAGGCGATTGCAGAGAA
AGCCCTGGCACTAGCAAGAAAAGAATCGGTTGATACAAGCGATTTCTTTACTGTCTTGGCTCACACACACCCTGCATCCAAGACAGTACTTGAGCAATGT
GCTTCCTATTTTAAGGAGGCAGTTACATTCTTGAACCTCAAGGGGCTAAAAGGTGGGACGGCAAGCTTGGATGTGCATTATGCTCTTGATGATGCTGAAT
CTTGTGAAAGTGCGTTGTCTTCAGGCCATGTTCATATTGATTCAGCTACTGCTAGAATCCAGAAATGGAAGACTGTCTATAGGGCTGCCGAAGCAGCTGT
TATAGCTCTTGAAAACTGA
AA sequence
>Potri.013G012733.1 pacid=42810827 polypeptide=Potri.013G012733.1.p locus=Potri.013G012733 ID=Potri.013G012733.1.v4.1 annot-version=v4.1
MGSKNRIMIFAAIVLHLFLHFPSQTEAGAELVSKVCKQSQDYQSCVQILTSHPQTLSASEKKAIAEKALALARKESVDTSDFFTVLAHTHPASKTVLEQC
ASYFKEAVTFLNLKGLKGGTASLDVHYALDDAESCESALSSGHVHIDSATARIQKWKTVYRAAEAAVIALEN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G012733 0 1
AT3G04070 NAC ANAC047 NAC domain containing protein ... Potri.001G256600 15.23 0.8228
AT1G24400 ATLHT2, AATL2, ... ARABIDOPSIS LYSINE HISTIDINE T... Potri.008G179000 18.33 0.8056
AT5G53540 P-loop containing nucleoside t... Potri.012G022985 21.81 0.8027
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Potri.001G261104 25.57 0.8379
AT3G56180 Protein of unknown function (D... Potri.008G075100 27.65 0.7932
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Potri.006G001600 31.30 0.7580
AT1G09155 ATPP2-B15 phloem protein 2-B15 (.1) Potri.013G012666 44.54 0.7518
AT3G19080 SWIB complex BAF60b domain-con... Potri.007G039350 71.59 0.7749
AT5G16330 NC domain-containing protein-r... Potri.005G056300 90.11 0.6423
Potri.004G151450 102.85 0.7077

Potri.013G012733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.