Potri.013G012766 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012800 232 / 5e-79 ND /
Potri.013G012733 230 / 2e-78 ND /
Potri.005G022200 183 / 1e-59 ND /
Potri.005G195200 144 / 7e-44 AT5G64620 42 / 7e-05 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G022300 140 / 2e-42 ND /
Potri.005G022400 139 / 5e-42 ND /
Potri.005G022250 137 / 2e-41 ND /
Potri.001G073350 104 / 1e-28 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040145 64 / 7e-13 ND 40 / 4e-04
Lus10000961 61 / 7e-12 ND 39 / 5e-04
Lus10035527 59 / 6e-11 AT4G24640 40 / 4e-04 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10007598 59 / 6e-11 ND 42 / 2e-04
Lus10011019 49 / 4e-07 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.013G012766.1 pacid=42811508 polypeptide=Potri.013G012766.1.p locus=Potri.013G012766 ID=Potri.013G012766.1.v4.1 annot-version=v4.1
ATGGATTCCAAGAATCGAATCATGATTTTTGCTGCCATTGTCTTGTATCTTTTCCTGCATTTTCCTTCACAAACCGAGGCAGGAGTGGAATTAGCGAGTA
AGGTTTGCAAACATAGCCAAAACTATGAATCCTGCGTTCAAACCCTGACGTCCCATCCACAAACTTTGGCAGCACCTAATGAAAAGGCGATTGCAGAGAA
AGCCCTGGAAATAGCAAGAAAAGTATCGGTAGATACAGGCGTTTTCTTTACTGGCTTGGCTCAAACAAACCCTGCATATAAGACAGCACTTGAGCAATGC
GCAACCAATTTTAAAGAGGCAGTTCAATTCTTGAACCTCATGGGGCTACAAGGTGGCACGGCAAGCTTAGATGTGCATTATGGTCTTGATGAAGTTAACC
AGTGTCAAGATGCATTGACTTCAGGCCATGTTCAAATTGATTCAGCTACTTCTATAATCCAGAAATGGAAGACTGTCTATGATGCTGCAGACGCAACTGT
AGCAACTCTTGAGAACTGA
AA sequence
>Potri.013G012766.1 pacid=42811508 polypeptide=Potri.013G012766.1.p locus=Potri.013G012766 ID=Potri.013G012766.1.v4.1 annot-version=v4.1
MDSKNRIMIFAAIVLYLFLHFPSQTEAGVELASKVCKHSQNYESCVQTLTSHPQTLAAPNEKAIAEKALEIARKVSVDTGVFFTGLAQTNPAYKTALEQC
ATNFKEAVQFLNLMGLQGGTASLDVHYGLDEVNQCQDALTSGHVQIDSATSIIQKWKTVYDAADATVATLEN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G012766 0 1
AT3G03760 AS2 LBD20 LOB domain-containing protein ... Potri.013G064501 5.00 0.5519
AT3G53510 ABCG20 ATP-binding cassette G20, ABC-... Potri.006G215100 11.31 0.5398
Potri.015G009450 14.42 0.4943
AT4G21410 CRK29 cysteine-rich RLK (RECEPTOR-li... Potri.011G028700 23.55 0.4950
AT5G07300 BON2 BONZAI 2, Calcium-dependent ph... Potri.003G055501 31.93 0.4852
Potri.004G127001 34.98 0.4337
AT5G06350 ARM repeat superfamily protein... Potri.011G096201 49.29 0.4507
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Potri.011G028901 53.58 0.4732
AT4G35270 NLP2 Plant regulator RWP-RK family ... Potri.005G251700 73.83 0.4167
Potri.003G014176 76.73 0.4180

Potri.013G012766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.