Potri.013G012800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012733 283 / 6e-99 ND /
Potri.013G012766 275 / 8e-96 ND /
Potri.005G022200 204 / 7e-68 ND /
Potri.005G195200 176 / 2e-56 AT5G64620 42 / 7e-05 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G022250 159 / 6e-50 ND /
Potri.005G022300 158 / 2e-49 ND /
Potri.005G022400 157 / 2e-49 ND /
Potri.001G073350 140 / 2e-42 ND /
Potri.001G127500 46 / 2e-06 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027768 93 / 6e-24 ND /
Lus10040145 91 / 5e-23 ND 40 / 4e-04
Lus10035527 90 / 9e-23 AT4G24640 40 / 4e-04 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10000961 89 / 2e-22 ND 39 / 5e-04
Lus10007598 88 / 9e-22 ND 42 / 2e-04
Lus10011019 72 / 7e-15 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
Lus10000822 46 / 3e-06 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017013 45 / 4e-06 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10008892 45 / 7e-06 AT1G47960 48 / 6e-07 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037793 44 / 2e-05 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.013G012800.1 pacid=42812772 polypeptide=Potri.013G012800.1.p locus=Potri.013G012800 ID=Potri.013G012800.1.v4.1 annot-version=v4.1
ATGGGTTCCAAGAATCGCGTCATGATTCTTGCTGCCACTGTCTTGTATCTCTCCCTGCATTTTCCTTCTCAAACTGAGGCAGGAGCGGAATTGGTGAGTA
AGGTTTGCAAACATGGCCAAAACTATGAATCCTGCGTTCAAACCCTGACGTCCGATCCACAAACTTTGTCAGCGCCTAATGGAAAGGCGATTGCAGAGAA
AGCCCTGGAAATAGCAAGAAAAGAATCGGTTGATACAAGCGATTTCTTTACTGGCTTGGCTCACACAAACCCTGCATCCAAGTCAGTACTTCAGCAATGT
GCATCCAATTTTAAAGAGGCAGTTCAATTCTTGAACCTCAGTGGGCTAGAAGGTGGCACGGCAAGCTTAGATGTGCATTATGCTCTTGATGATGCTGAAT
CTTGTGAAAGTGTAATGTCTTCAGGCCGTGTTCAAATTGATTCAGCTGCTGCTAGAATCCAGAAATGGACGACTGTCTATGATGCTGCCCAGGCAACCGT
AGTATTTCTGGAAAATTGA
AA sequence
>Potri.013G012800.1 pacid=42812772 polypeptide=Potri.013G012800.1.p locus=Potri.013G012800 ID=Potri.013G012800.1.v4.1 annot-version=v4.1
MGSKNRVMILAATVLYLSLHFPSQTEAGAELVSKVCKHGQNYESCVQTLTSDPQTLSAPNGKAIAEKALEIARKESVDTSDFFTGLAHTNPASKSVLQQC
ASNFKEAVQFLNLSGLEGGTASLDVHYALDDAESCESVMSSGRVQIDSAAARIQKWTTVYDAAQATVVFLEN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G012800 0 1
AT1G14540 Peroxidase superfamily protein... Potri.001G458900 3.31 0.5965
AT1G76210 Arabidopsis protein of unknown... Potri.005G248700 30.59 0.5312
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Potri.011G112900 40.39 0.5316
AT1G53440 Leucine-rich repeat transmembr... Potri.016G061500 60.00 0.5238
Potri.002G118950 73.75 0.4709
Potri.002G234850 109.48 0.4752
AT4G22080 RHS14 root hair specific 14 (.1) Potri.011G008000 112.71 0.4564
AT2G32460 MYB ATMYB101, AtM1 ARABIDOPSIS THALIANA MYB 1, my... Potri.002G228700 157.86 0.4492
AT5G20045 unknown protein Potri.008G015100 210.18 0.4305
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Potri.002G193300 218.63 0.4268

Potri.013G012800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.