Potri.013G014900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G54070 48 / 1e-07 Dormancy/auxin associated family protein (.1)
AT1G28330 43 / 7e-06 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
AT2G33830 38 / 0.0002 Dormancy/auxin associated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G024250 114 / 8e-34 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.003G070500 54 / 6e-10 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
Potri.001G164800 48 / 9e-08 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
Potri.004G047100 46 / 7e-07 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020661 97 / 9e-27 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10015193 97 / 2e-26 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10031488 96 / 3e-26 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10029881 100 / 6e-26 AT5G27830 245 / 9e-80 unknown protein
Lus10013180 47 / 6e-07 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1)
Lus10025446 44 / 1e-06 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
Lus10008142 44 / 4e-06 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Lus10013996 43 / 4e-06 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013997 43 / 4e-06 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015318 43 / 6e-06 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Potri.013G014900.2 pacid=42811577 polypeptide=Potri.013G014900.2.p locus=Potri.013G014900 ID=Potri.013G014900.2.v4.1 annot-version=v4.1
ATGAGTCTTCTTGATCATCTCTGGGACGACACCGTTGCTGGTCCTCTTCCGGAAAACGGCCTCGGGAAGCTACGGAAGAAACCGAGCTACGGTCTCCGGT
CAAACTCCGGCAAGGAATCTGATGGTAGTGGTGGTAGCGTGATGAGGTCGTACGGTGGTGAAGCGACGACGGAGGAGACGAAGAAAGTGACAAGGAGTAT
CATGATAGTAAGACCACCGGGATACCAGAATAACGGTTCCTCTGCTACTCCCCCGGCGTCACCAGCTGGTTCTACTCCTCCGGTGTCTCCTTTCTCTGCA
GAGAGTCCTTTCGGTTTCGAAGAAGGTCTACGTCGGACGCATACGAGAAGACAACCGAGGTTGGACCCAGAATTCCTACTTCTCCTTACGGCGAATGATA
TATGA
AA sequence
>Potri.013G014900.2 pacid=42811577 polypeptide=Potri.013G014900.2.p locus=Potri.013G014900 ID=Potri.013G014900.2.v4.1 annot-version=v4.1
MSLLDHLWDDTVAGPLPENGLGKLRKKPSYGLRSNSGKESDGSGGSVMRSYGGEATTEETKKVTRSIMIVRPPGYQNNGSSATPPASPAGSTPPVSPFSA
ESPFGFEEGLRRTHTRRQPRLDPEFLLLLTANDI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G56220 Dormancy/auxin associated fami... Potri.013G014900 0 1
AT2G35760 Uncharacterised protein family... Potri.016G008800 2.00 0.7559
AT2G12550 NUB1 homolog of human NUB1, ubiquit... Potri.018G118143 2.82 0.7640
AT1G14870 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1... Potri.008G132900 8.00 0.7037
AT1G15880 ATGOS11, GOS11 golgi snare 11 (.1) Potri.003G180800 12.32 0.7302 GOS11.2
AT2G26850 F-box family protein (.1) Potri.006G040000 15.19 0.7084
AT3G17210 ATHS1 A. THALIANA HEAT STABLE PROTEI... Potri.010G037500 15.42 0.7033
AT1G22040 Galactose oxidase/kelch repeat... Potri.002G091900 18.97 0.6883
AT4G32330 TPX2 (targeting protein for Xk... Potri.018G027500 20.92 0.7521
AT1G32410 Vacuolar protein sorting 55 (V... Potri.001G146600 22.13 0.7324
AT5G49610 F-box family protein (.1) Potri.007G027300 23.81 0.6492

Potri.013G014900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.