Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPL22.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05560 172 / 8e-57 Ribosomal L22e protein family (.1.2.3) AT5G27770 149 / 2e-47 Ribosomal L22e protein family (.1) AT1G02830 126 / 2e-38 Ribosomal L22e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G128800 [exp] 182 / 9e-61 AT3G05560 173 / 2e-57 Ribosomal L22e protein family (.1.2.3) Potri.005G024400 [exp] 181 / 3e-60 AT3G05560 174 / 9e-58 Ribosomal L22e protein family (.1.2.3) Potri.002G204100 [exp] 180 / 7e-60 AT3G05560 172 / 8e-57 Ribosomal L22e protein family (.1.2.3) Potri.010G012700 [exp] 174 / 2e-57 AT3G05560 170 / 8e-56 Ribosomal L22e protein family (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037498 [exp] 181 / 3e-60 AT3G05560 197 / 1e-66 Ribosomal L22e protein family (.1.2.3) Lus10006509 [exp] 180 / 9e-60 AT3G05560 196 / 3e-66 Ribosomal L22e protein family (.1.2.3) Lus10026555 [exp] 110 / 9e-33 AT3G05560 118 / 3e-36 Ribosomal L22e protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01776 [poplar] [flax] Ribosomal_L22e Ribosomal L22e protein family
Representative CDS sequence Show only first row Show all	>Potri.013G015300.1 pacid=42811606 polypeptide=Potri.013G015300.1.p locus=Potri.013G015300 ID=Potri.013G015300.1.v4.1 annot-version=v4.1 ATGAGTAAGGCAACAGCACCAGGACCCAAAGGGAAGAAGAAGGGTGCGACCTTCACAATAGATTGTGCAAAGCCAGTGGAGGATAAGATTATGGACATTG CTTCATTGGAAAAGTTTCTTCAAGAGAGGATCAAAGTTGGAGGCAAAGCTGGTGCTCTTGGTGATGCTGTTACTGTTACTCGTGAGAAGAACAAGATTAC TGTTACTTCTGATAGTAACTTCTCCAAAAGGTATCTCAAGTACTTGACAAAGAAGTATTTGAAGAAACACAATGTCAGGGATTGGCTACGAGTGATTGCA TCCAACAAAGATCGCAATGTGTACGAGTTGAGATACTTCAACATTGCTGAGAACGAGGGAGAGGAGGAAGATTGA
AA sequence Show only first row Show all	>Potri.013G015300.1 pacid=42811606 polypeptide=Potri.013G015300.1.p locus=Potri.013G015300 ID=Potri.013G015300.1.v4.1 annot-version=v4.1 MSKATAPGPKGKKKGATFTIDCAKPVEDKIMDIASLEKFLQERIKVGGKAGALGDAVTVTREKNKITVTSDSNFSKRYLKYLTKKYLKKHNVRDWLRVIA SNKDRNVYELRYFNIAENEGEEED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05560			Ribosomal L22e protein family ...		Potri.013G015300 [exp]	0	1	Pt-RPL22.3
AT1G73230			Nascent polypeptide-associated...		Potri.012G037900 [exp]	3.46	0.9507
AT5G39740		OLI7, RPL5B	OLIGOCELLULA 7, ribosomal prot...		Potri.019G099000 [exp]	6.00	0.9510
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Potri.002G056200 [exp]	6.48	0.9492	Pt-RPS12.2
AT2G27530		PGY1	PIGGYBACK1, Ribosomal protein ...		Potri.004G202832 [exp]	7.00	0.9512
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.008G013200 [exp]	7.93	0.9487	RPS28.2
AT3G59540			Ribosomal L38e protein family ...		Potri.010G181200 [exp]	8.24	0.9380	Pt-RPL38.2
AT4G18100			Ribosomal protein L32e (.1)		Potri.002G249000 [exp]	8.36	0.9503
AT5G02610			Ribosomal L29 family protein ...		Potri.008G048800 [exp]	9.32	0.9507	RPL35.1
AT3G59540			Ribosomal L38e protein family ...		Potri.007G131800 [exp]	11.61	0.9458
AT3G60770			Ribosomal protein S13/S15 (.1)		Potri.002G146800 [exp]	14.96	0.9477	RPS13.3

Compare expression of checked genes

Potri.013G015300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.