Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09140 263 / 7e-88 ATSRP30.1, ATSRP30.2, SR30, At-SR30 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) AT1G02840 257 / 3e-85 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT4G02430 243 / 9e-80 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G49430 239 / 9e-78 SRP34A, SR34a, At-SR34a Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) AT3G53500 63 / 3e-11 RSZ32, RS2Z32, At-RS2Z arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT2G37340 63 / 3e-11 RSZ33, ATRSZ33, RS2Z33, AT-RS2Z33 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) AT2G24590 59 / 2e-10 RSZ22a, At-RSZ22a RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT3G61860 59 / 4e-10 ATRSP31, At-RS31 arginine/serine-rich splicing factor 31, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G31580 58 / 6e-10 SRZ22, RSZP22, SRZ-22, RSZ22, At-RSZ22 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) AT1G23860 55 / 4e-09 SRZ21, SRZ-21, RSZP21, RSZ21, At-RSZ21 RS-containing zinc finger protein 21 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G024600 [exp] 295 / 8e-100 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.014G129900 [exp] 279 / 1e-93 AT1G02840 272 / 5e-91 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.002G205025 [exp] 276 / 1e-92 AT1G02840 272 / 1e-90 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.015G004600 [exp] 244 / 2e-80 AT3G49430 303 / 1e-103 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) Potri.012G021800 [exp] 232 / 3e-75 AT3G49430 317 / 2e-108 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) Potri.016G081700 [exp] 68 / 5e-13 AT2G37340 268 / 2e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.006G215200 [exp] 68 / 8e-13 AT2G37340 266 / 6e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.014G101800 [exp] 62 / 5e-11 AT3G61860 319 / 9e-111 arginine/serine-rich splicing factor 31, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.019G050600 [exp] 61 / 7e-11 AT1G23860 131 / 3e-39 RS-containing zinc finger protein 21 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020656 [exp] 285 / 4e-95 AT1G02840 297 / 2e-100 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10003606 [exp] 275 / 3e-92 AT1G02840 299 / 5e-102 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10007869 [exp] 270 / 2e-90 AT1G02840 308 / 1e-105 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10029885 [exp] 256 / 4e-82 AT1G02840 253 / 2e-81 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10015564 [exp] 248 / 4e-82 AT3G49430 324 / 6e-112 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) Lus10032940 [exp] 249 / 1e-81 AT3G49430 328 / 7e-113 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) Lus10008218 [exp] 204 / 7e-64 AT1G02840 228 / 3e-73 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10030374 [exp] 139 / 6e-40 AT1G02840 147 / 8e-45 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10026925 [exp] 63 / 1e-11 AT4G31580 184 / 2e-59 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10020123 [exp] 63 / 1e-11 AT4G31580 188 / 2e-61 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.013G015500.2 pacid=42812216 polypeptide=Potri.013G015500.2.p locus=Potri.013G015500 ID=Potri.013G015500.2.v4.1 annot-version=v4.1 ATGAGCCGAGCAAGTCGAACACTTTACGTCGGAAATCTTCCTGGTGATATTCGCCTGAGGGAAGTTGAAGATTTGTTTTATAAGTATGGGCCCATTGTCG ACATTGATTTGAAAATCCCGCCAAGGCCTCCAGGCTATGCTTTTGTTGAGTTTGAAGAAGCTCGTGATGCTGAAGATGCAATTCGTGGCCGGGATGGATA TAATTTTGATGGGTGTAGATTACGGGTTGAGCTTGCCCATGGTGGGCGAAGACATTCATCACCAGTGGATCATTATAGCAGTTACAGTGGTAGCAGTGGT AGCCGTGGGCCTTCCAAGCGCTCTGACTATCGTGTGTTAGTGACTGGATTGCCTTCTTCTGCTTCATGGCAAGACCTAAAGGATCATATGCGTCGAGCTG GTGATGTCTGCTTTTCTCAAGTCTTTCGTGATCGTGGTGGCATGACAGGAATTGTGGACTACACAAACTATGATGACATGAAATATGCTATCAAGAAGCT TGATGACTCTGAGTTCCGGAATGCATTTTCAAGGGCATATATTCGGGTGAGGGAGTATGATTCTAGACGGAGTTACTCTAGGAGCCCCAGTCTCAGTTCA TATGTGTCAAGAAGCCGGAGTCGAAGTCGCAGTGGAGGCTATAGTGACAGGAGCTGGAGCAAGTCTCCCAGGGCAAAACATTCACGGCGTTCTCGATCTG TATCTGTTTCTTCTCGCTCTCGTGCAGGATCATCTCCACGATCTTTTTCAAGGTCCCTTTCAAGATCAAGATCTCCTCTTGCTTCTCCTCCTCGCAGAAA ACATGGCCACAGAACCCCAAGCATAAGCCCTGGTCGTGTATCCCGTTCGCCTTCTGTGAGGTCTGATCGAAGCCTTTCGGTGGACTCAGATCGTTGA
AA sequence Show only first row Show all	>Potri.013G015500.2 pacid=42812216 polypeptide=Potri.013G015500.2.p locus=Potri.013G015500 ID=Potri.013G015500.2.v4.1 annot-version=v4.1 MSRASRTLYVGNLPGDIRLREVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEEARDAEDAIRGRDGYNFDGCRLRVELAHGGRRHSSPVDHYSSYSGSSG SRGPSKRSDYRVLVTGLPSSASWQDLKDHMRRAGDVCFSQVFRDRGGMTGIVDYTNYDDMKYAIKKLDDSEFRNAFSRAYIRVREYDSRRSYSRSPSLSS YVSRSRSRSRSGGYSDRSWSKSPRAKHSRRSRSVSVSSRSRAGSSPRSFSRSLSRSRSPLASPPRRKHGHRTPSISPGRVSRSPSVRSDRSLSVDSDR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G09140		ATSRP30.1, ATSR...	Serine/Arginine-Rich Protein S...		Potri.013G015500 [exp]	0	1
AT5G42820	C3HZnF	ATU2AF35B	Zinc finger C-x8-C-x5-C-x3-H t...		Potri.004G188900 [exp]	1.00	0.9030
AT2G35510		SRO1	similar to RCD one 1 (.1)		Potri.002G112300 [exp]	17.54	0.8274
AT5G35320			unknown protein		Potri.006G070900 [exp]	18.81	0.8593
AT2G45380			unknown protein		Potri.014G069100 [exp]	20.19	0.8772
AT5G35320			unknown protein		Potri.018G132600 [exp]	22.00	0.8567
AT2G20560			DNAJ heat shock family protein...		Potri.017G016000 [exp]	28.61	0.8342
AT3G24500		MBF1C, ATMBF1C	multiprotein bridging factor 1...		Potri.018G075200 [exp]	37.48	0.8489
AT4G22740			glycine-rich protein (.1.2)		Potri.003G115400 [exp]	38.24	0.8474
AT4G34100			RING/U-box superfamily protein...		Potri.001G304100 [exp]	38.30	0.8456
AT1G78070			Transducin/WD40 repeat-like su...		Potri.002G094100 [exp]	38.53	0.7565

Compare expression of checked genes

Potri.013G015500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.