Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1) AT3G53890 149 / 8e-49 Ribosomal protein S21e (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G026000 [exp] 175 / 4e-59 AT5G27700 153 / 2e-50 Ribosomal protein S21e (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015173 [exp] 160 / 3e-53 AT5G27700 151 / 1e-49 Ribosomal protein S21e (.1) Lus10020645 [exp] 158 / 2e-52 AT5G27700 151 / 7e-50 Ribosomal protein S21e (.1) Lus10010971 [exp] 134 / 2e-41 AT5G27700 128 / 7e-39 Ribosomal protein S21e (.1) Lus10031494 [exp] 94 / 3e-27 AT5G27700 89 / 2e-25 Ribosomal protein S21e (.1) Lus10029895 [exp] 0 / 1 AT5G27700 85 / 2e-32 Ribosomal protein S21e (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01249 [poplar] [flax] Ribosomal_S21e Ribosomal protein S21e
Representative CDS sequence Show only first row Show all	>Potri.013G017600.5 pacid=42812451 polypeptide=Potri.013G017600.5.p locus=Potri.013G017600 ID=Potri.013G017600.5.v4.1 annot-version=v4.1 ATGCAGAACGAAGAGGGACAAAACATGGATCTTTACATCCCCAGGAAATGCTCCGCCACAAACAGGCTTATCACCTCTAAGGACCATGCGTCTGTTCAGA TTAATATTGGTCATTTGGATGCCAGTGGTCATTACACTGGCCAGTTCACCACTTTTGCGCTATGTGGCTTCGTCCGTGCCCAGGGTGATGCTGACAGTGC CGTGGACAGGCTTTGGCAAAAGAAGAAGACTGAACTCCGCCAGCAGTAA
AA sequence Show only first row Show all	>Potri.013G017600.5 pacid=42812451 polypeptide=Potri.013G017600.5.p locus=Potri.013G017600 ID=Potri.013G017600.5.v4.1 annot-version=v4.1 MQNEEGQNMDLYIPRKCSATNRLITSKDHASVQINIGHLDASGHYTGQFTTFALCGFVRAQGDADSAVDRLWQKKKTELRQQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27700			Ribosomal protein S21e (.1)		Potri.013G017600 [exp]	0	1
AT5G59850			Ribosomal protein S8 family pr...		Potri.001G118100 [exp]	1.41	0.9580	Pt-WRP15.2
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Potri.011G148700 [exp]	2.00	0.9523	RPL9.5
AT3G53740			Ribosomal protein L36e family ...		Potri.012G142600 [exp]	3.87	0.9518
AT1G67430			Ribosomal protein L22p/L17e fa...		Potri.008G175500 [exp]	5.65	0.9338
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Potri.002G140400 [exp]	5.91	0.9496	Pt-RPS11.5
AT5G09500			Ribosomal protein S19 family p...		Potri.002G043200 [exp]	6.00	0.9511
AT1G17880		ATBTF3	basic transcription factor 3 (...		Potri.015G029800 [exp]	6.40	0.9084
AT2G37600			Ribosomal protein L36e family ...		Potri.004G057000 [exp]	6.63	0.9383	RPL36.1
AT3G05590		RPL18	ribosomal protein L18 (.1)		Potri.005G023500 [exp]	8.83	0.9368	Pt-RPL18.12
AT3G05560			Ribosomal L22e protein family ...		Potri.014G128800 [exp]	9.16	0.9485	RPL22.2

Compare expression of checked genes

Potri.013G017600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.