Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27670 158 / 1e-50 HTA7 histone H2A 7 (.1) AT5G59870 154 / 1e-48 HTA6 histone H2A 6 (.1) AT5G02560 150 / 3e-47 HTA12 histone H2A 12 (.1.2) AT1G08880 141 / 6e-44 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) AT1G54690 140 / 8e-44 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) AT1G51060 138 / 7e-43 HTA10 histone H2A 10 (.1) AT4G27230 138 / 8e-43 HTA2 histone H2A 2 (.1.2) AT3G20670 138 / 9e-43 HTA13 histone H2A 13 (.1) AT5G54640 136 / 3e-42 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1) AT2G38810 90 / 8e-24 HTA8 histone H2A 8 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G026500 [exp] 167 / 4e-54 AT5G27670 145 / 2e-45 histone H2A 7 (.1) Potri.006G082300 [exp] 155 / 2e-49 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2) Potri.013G028800 [exp] 142 / 3e-44 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028900 [exp] 142 / 3e-44 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040800 [exp] 141 / 5e-44 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040700 [exp] 140 / 2e-43 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.011G131400 [exp] 137 / 2e-42 AT1G51060 200 / 1e-67 histone H2A 10 (.1) Potri.004G031300 [exp] 136 / 4e-42 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.001G415700 [exp] 137 / 6e-42 AT1G51060 174 / 1e-56 histone H2A 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004502 [exp] 161 / 1e-51 AT5G27670 222 / 2e-75 histone H2A 7 (.1) Lus10029899 [exp] 160 / 5e-51 AT5G27670 214 / 3e-72 histone H2A 7 (.1) Lus10040853 [exp] 157 / 8e-50 AT5G02560 228 / 4e-78 histone H2A 12 (.1.2) Lus10005892 [exp] 157 / 8e-50 AT5G02560 230 / 1e-78 histone H2A 12 (.1.2) Lus10005444 [exp] 155 / 3e-49 AT5G02560 234 / 2e-80 histone H2A 12 (.1.2) Lus10004945 [exp] 154 / 8e-49 AT5G02560 233 / 5e-80 histone H2A 12 (.1.2) Lus10023754 [exp] 150 / 3e-47 AT5G02560 233 / 2e-79 histone H2A 12 (.1.2) Lus10039691 [exp] 143 / 1e-44 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10027154 [exp] 143 / 1e-44 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10003750 [exp] 140 / 1e-43 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4 CL0012 [poplar] [flax] PF16211 [poplar] [flax] Histone_H2A_C C-terminus of histone H2A
Representative CDS sequence Show only first row Show all	>Potri.013G018200.1 pacid=42812208 polypeptide=Potri.013G018200.1.p locus=Potri.013G018200 ID=Potri.013G018200.1.v4.1 annot-version=v4.1 ATGGAGGCAACAACAAAGGCAACGAAAGGTGCAGGAGGAAGGAGAGGAGGAGAACGAAAGAAGTCAGTTTCGAAGTCAACCAAAGCTGGTCTTCAGTTCC CTGTGGGTCGTATCGCTAGGTTCTTGAAGAAAGGTCGTTACGCTCAACGTGTTGGTTCTGGTGCTCCTATTTACATGGCAGCTGTTCTTGAATATCTCGC TGCTGAGGTGTTGGAATTGGCCGGAAACGCAGCAAGAGACAACAAGAAAAACAGAATAAACCCAAGACACGTCTTGTTGGCTATAAGAAACGATGAAGAA CTGGGAAAATTGCTGCAGGGCGTTACAATCGCAAGCGGAGGAGTGTTGCCTAACATTAACCCAGTTCTTTTACCCAAGAAAAGTGCAAGCAGTGAGAAAT CTTCTGGATCCGAGCCCAAATCTCCTAAAAAGGCCTAA
AA sequence Show only first row Show all	>Potri.013G018200.1 pacid=42812208 polypeptide=Potri.013G018200.1.p locus=Potri.013G018200 ID=Potri.013G018200.1.v4.1 annot-version=v4.1 MEATTKATKGAGGRRGGERKKSVSKSTKAGLQFPVGRIARFLKKGRYAQRVGSGAPIYMAAVLEYLAAEVLELAGNAARDNKKNRINPRHVLLAIRNDEE LGKLLQGVTIASGGVLPNINPVLLPKKSASSEKSSGSEPKSPKKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27670		HTA7	histone H2A 7 (.1)		Potri.013G018200 [exp]	0	1
AT1G08880		HTA5 ,G-H2AX ,G...	histone H2A 5, gamma histone v...		Potri.004G031300 [exp]	1.73	0.9625
AT5G65360			Histone superfamily protein (....		Potri.014G096900 [exp]	2.44	0.9579	HTR906
AT5G27670		HTA7	histone H2A 7 (.1)		Potri.005G026500 [exp]	3.00	0.9529	HTA914
AT5G65360			Histone superfamily protein (....		Potri.005G233900 [exp]	3.46	0.9267
AT5G10110			unknown protein		Potri.005G077400 [exp]	4.89	0.8991
AT1G08880		HTA5 ,G-H2AX ,G...	histone H2A 5, gamma histone v...		Potri.013G028800 [exp]	5.91	0.9165
AT5G65360			Histone superfamily protein (....		Potri.001G016700 [exp]	6.70	0.9055
AT5G65360			Histone superfamily protein (....		Potri.002G028800 [exp]	6.92	0.9161
AT5G65360			Histone superfamily protein (....		Potri.001G016900 [exp]	7.07	0.9030
AT5G59970			Histone superfamily protein (....		Potri.006G168100 [exp]	7.93	0.9134

Compare expression of checked genes

Potri.013G018200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.