Plant FIBer expression Database

Potri.013G022350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.013G022350.1 pacid=42812551 polypeptide=Potri.013G022350.1.p locus=Potri.013G022350 ID=Potri.013G022350.1.v4.1 annot-version=v4.1
ATGGCAAAACCAGTGCCAAATCTCATTAAAAATTACCCAGAAGATCAACTGCGTTATTTGTTTACGAAAATATTAACTGCTTCAGATATCAAGTATGGCT
TAATACTTATGGGACAAGCTTCAAAGGACCATCTACAGGGCTTTAAAGATCAAAGAGTTAAGACCATGCTACATACACCAGCTTTATCCCAACCTGTGTT
CTTCAAGTCCTGTGATAGGATGATGTCACTGTGCCAGGGTGGTTGGGGTGTGATTGTTAGAGGTAATGGCTTTGTTGCTGGCGATATAATTAATTGCTGG
TTTGCTTATGATGAAGAAAGCAGAGTCCTAAACTTGATCATGGAAAGGGCTGCCAATGAGAGTGCTGGACCGGCTGCCCAGCAAGCTGAGGCTGGTGGAG
ATGCCGGACAAGCAGCCGGGGCGGGTGGAAATGGGAAGGGTGGTCAGCAGTGA
AA sequence
>Potri.013G022350.1 pacid=42812551 polypeptide=Potri.013G022350.1.p locus=Potri.013G022350 ID=Potri.013G022350.1.v4.1 annot-version=v4.1
MAKPVPNLIKNYPEDQLRYLFTKILTASDIKYGLILMGQASKDHLQGFKDQRVKTMLHTPALSQPVFFKSCDRMMSLCQGGWGVIVRGNGFVAGDIINCW
FAYDEESRVLNLIMERAANESAGPAAQQAEAGGDAGQAAGAGGNGKGGQQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G022350
[exp]
0 1
AT3G45180 Ubiquitin-like superfamily pro... Potri.004G211600
[exp]
6.16 0.9467
Potri.003G131550
[exp]
14.76 0.9433
AT5G03990 unknown protein Potri.006G045900
[exp]
24.12 0.9327
AT2G32120 HSP70T-2 heat-shock protein 70T-2 (.1.2... Potri.008G152000
[exp]
27.56 0.9328
AT3G24500 MBF1C, ATMBF1C multiprotein bridging factor 1... Potri.018G075200
[exp]
36.66 0.9246
AT1G71000 Chaperone DnaJ-domain superfam... Potri.010G113400
[exp]
37.62 0.9251
AT1G01800 NAD(P)-binding Rossmann-fold s... Potri.002G156866
[exp]
39.10 0.9259
AT2G33460 RIC1 ROP-interactive CRIB motif-con... Potri.008G168900
[exp]
42.66 0.9261 Pt-RIC1.1
AT2G38870 Serine protease inhibitor, pot... Potri.010G075800
[exp]
49.14 0.9247
AT1G01800 NAD(P)-binding Rossmann-fold s... Potri.002G156750
[exp]
52.15 0.9238

Potri.013G022350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.