Potri.013G023000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05327 193 / 1e-62 Cyclin family protein (.1)
AT3G63120 161 / 5e-50 CYCP1;1 cyclin p1;1 (.1)
AT2G44740 154 / 2e-47 CYCP4;1 cyclin p4;1 (.1)
AT5G07450 151 / 4e-46 CYCP4;3 cyclin p4;3 (.1)
AT3G21870 145 / 8e-44 CYCP2;1 cyclin p2;1 (.1)
AT5G61650 142 / 2e-42 CYCP4;2 CYCLIN P4;2 (.1)
AT3G60550 135 / 7e-40 CYCP3;2 cyclin p3;2 (.1)
AT2G45080 135 / 9e-40 CYCP3;1 cyclin p3;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G033600 344 / 2e-122 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Potri.005G209800 227 / 8e-76 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.002G052800 224 / 2e-74 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.007G121500 170 / 2e-53 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.014G050400 159 / 2e-49 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.012G114600 157 / 4e-48 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.015G112140 154 / 2e-47 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.002G143400 146 / 5e-44 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.014G066400 144 / 3e-43 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022038 212 / 1e-69 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10042582 212 / 1e-69 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10029933 208 / 2e-68 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10004475 207 / 5e-68 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10039697 154 / 6e-47 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10027148 155 / 7e-47 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10032505 148 / 2e-44 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 147 / 6e-44 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10042873 144 / 7e-43 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 132 / 8e-39 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.013G023000.3 pacid=42811156 polypeptide=Potri.013G023000.3.p locus=Potri.013G023000 ID=Potri.013G023000.3.v4.1 annot-version=v4.1
ATGGCTGCTGAATCAGAAACTTTCATGGCTTTGGGTCTGTTAGATGAATCCAGTAGAGGAGTTTCGGGAACTCCACGGGTGCTGGTGCTTATTGCATCTG
TTCTCGAGAAATCCCTTCAAAATAACGAAAAGCTGTTAACTACGTCAAGAAGAAAGGATGCTATTACCATCTTCCATGGCTCAAGATCTCCCACCTTGAG
CATTAGACAGTACATCGAACGCGTATTCAAGTACTCGAGGTGCAGCACTTCTTGCTTTGTTGTTGCCTATATATACATCAACAAGTTCCTTCAGCAAACG
GATGCCTATCTTACCTCCCTGAATGCACACCGTCTTCTGATCACAAGCATCATGGTAGCTGCAAAGTTCTTGGATGATGATTGTTATGACAATGCCTATT
ATGCCAGGATTGGAGGTGTAAGCACTGCAGAAATGAATAGAATGGAGATGAAATTCTTGTTCAATTTGGATTTTAGGCTCCATGTTACAGCTGAAGTATT
CATGAACTGCTGCTTGAAACTGGAAAATGAAAGTGGGAAGTACCAGAATGGCCAGGCCGGTCCAAGCTTGTGGCCTCGAAGAAGGCCAGCAAGACAAAGA
TGA
AA sequence
>Potri.013G023000.3 pacid=42811156 polypeptide=Potri.013G023000.3.p locus=Potri.013G023000 ID=Potri.013G023000.3.v4.1 annot-version=v4.1
MAAESETFMALGLLDESSRGVSGTPRVLVLIASVLEKSLQNNEKLLTTSRRKDAITIFHGSRSPTLSIRQYIERVFKYSRCSTSCFVVAYIYINKFLQQT
DAYLTSLNAHRLLITSIMVAAKFLDDDCYDNAYYARIGGVSTAEMNRMEMKFLFNLDFRLHVTAEVFMNCCLKLENESGKYQNGQAGPSLWPRRRPARQR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05327 Cyclin family protein (.1) Potri.013G023000 0 1
AT5G49890 ATCLC-C, CLC-C chloride channel C (.1) Potri.018G138100 3.16 0.8966
AT5G05280 RING/U-box superfamily protein... Potri.001G159300 10.00 0.8433
AT1G76800 Vacuolar iron transporter (VIT... Potri.005G190800 12.16 0.9119
AT1G15670 Galactose oxidase/kelch repeat... Potri.006G196900 12.64 0.8843
AT1G72770 HAB1 HYPERSENSITIVE TO ABA1, homolo... Potri.006G224600 16.58 0.8117
AT1G11300 protein serine/threonine kinas... Potri.004G027533 22.29 0.8753
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.012G120160 22.44 0.8846
AT2G44830 Protein kinase superfamily pro... Potri.014G047500 22.51 0.8695
Potri.002G120651 23.45 0.8522
AT3G18430 Calcium-binding EF-hand family... Potri.003G030300 26.26 0.8532

Potri.013G023000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.