Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54860 62 / 1e-12 Glycoprotein membrane precursor GPI-anchored (.1) AT5G19250 61 / 2e-12 Glycoprotein membrane precursor GPI-anchored (.1) AT3G06035 61 / 2e-12 Glycoprotein membrane precursor GPI-anchored (.1) AT5G19230 39 / 0.0003 Glycoprotein membrane precursor GPI-anchored (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G034200 [exp] 97 / 2e-26 AT1G54860 110 / 2e-30 Glycoprotein membrane precursor GPI-anchored (.1) Potri.005G034400 [exp] 84 / 4e-21 AT1G54860 167 / 6e-53 Glycoprotein membrane precursor GPI-anchored (.1) Potri.005G034300 [exp] 79 / 2e-19 AT1G54860 99 / 5e-26 Glycoprotein membrane precursor GPI-anchored (.1) Potri.008G195000 [exp] 63 / 5e-13 AT3G06035 231 / 2e-77 Glycoprotein membrane precursor GPI-anchored (.1) Potri.010G033400 [exp] 63 / 6e-13 AT3G06035 214 / 4e-71 Glycoprotein membrane precursor GPI-anchored (.1) Potri.013G023801 [exp] 40 / 4e-05 AT1G54860 102 / 4e-28 Glycoprotein membrane precursor GPI-anchored (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004470 [exp] 64 / 1e-13 AT1G54860 190 / 2e-61 Glycoprotein membrane precursor GPI-anchored (.1) Lus10029938 [exp] 64 / 1e-12 AT1G08960 640 / 0.0 cation calcium exchanger 5, Arabidopsis thaliana cation calcium exchanger 5, cation exchanger 11 (.1) Lus10034054 [exp] 61 / 3e-12 AT3G06035 220 / 2e-73 Glycoprotein membrane precursor GPI-anchored (.1) Lus10010516 [exp] 61 / 5e-12 AT3G06035 226 / 9e-76 Glycoprotein membrane precursor GPI-anchored (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G023701.1 pacid=42811215 polypeptide=Potri.013G023701.1.p locus=Potri.013G023701 ID=Potri.013G023701.1.v4.1 annot-version=v4.1 ATGATGATATATCCATCTGAGGTGGTTCAACTAGACGACTACCCTACACAATTAAAACACTGCTATGGCAGTAGTAGCCACACCACAGATGTTGCCATAT TGCCTATTTGCATACCGGGAAATGATGAACAGACTCTTACAAATTTTCAAAATTATAGTCGCAGTCAGTATGAGAAGTACGTAAACGAGTCAGGTTATAG GGGGGCTGGAGTTGGTGGTAATGAGAATTGGATGGTGGTTGTTTTTGTCGAAAACACCACAAGCTGGACTTCAGCAGGAGGAGCAAAACACAGTTTGGTT TCAGAGGTCGGTTGTGGCCATTGCCTGGTGTCTTTGTTGCTAGGGATATTGCTCTTTTATCTAGTTTTATAA
AA sequence Show only first row Show all	>Potri.013G023701.1 pacid=42811215 polypeptide=Potri.013G023701.1.p locus=Potri.013G023701 ID=Potri.013G023701.1.v4.1 annot-version=v4.1 MMIYPSEVVQLDDYPTQLKHCYGSSSHTTDVAILPICIPGNDEQTLTNFQNYSRSQYEKYVNESGYRGAGVGGNENWMVVVFVENTTSWTSAGGAKHSLV SEVGCGHCLVSLLLGILLFYLVL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54860			Glycoprotein membrane precurso...		Potri.013G023701 [exp]	0	1
AT3G17380			TRAF-like family protein (.1)		Potri.008G099600 [exp]	6.92	0.9169
AT5G45540			Protein of unknown function (D...		Potri.012G018400 [exp]	8.60	0.9152
AT1G03670			ankyrin repeat family protein ...		Potri.013G133900 [exp]	10.53	0.9082
AT4G03500			Ankyrin repeat family protein ...		Potri.011G016100 [exp]	16.97	0.9015
AT5G45480			Protein of unknown function (D...		Potri.016G012400 [exp]	19.13	0.8977
AT1G54400			HSP20-like chaperones superfam...		Potri.013G054800 [exp]	19.23	0.8991
AT5G42110			unknown protein		Potri.011G151900 [exp]	23.36	0.8205
AT1G60500		DRP4C	Dynamin related protein 4C (.1...		Potri.013G120000 [exp]	24.24	0.8971
					Potri.016G028501 [exp]	26.49	0.8829
AT2G44930			Plant protein of unknown funct...		Potri.017G019300 [exp]	26.83	0.8878

Compare expression of checked genes

Potri.013G023701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.