Plant FIBer expression Database

Potri.013G028450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.013G028450.1 pacid=42811719 polypeptide=Potri.013G028450.1.p locus=Potri.013G028450 ID=Potri.013G028450.1.v4.1 annot-version=v4.1
ATGTACTTCGGTGTCAAATATCAAAAACAAAGAAAACTCCACTTTGATGGGGTGATTTGTTTATCTCCTGCAGTATATTTAAATCAACCATTCCATAATC
CATGCATTACATTCAATGAATGGATGTGTTTTTTCATCAAGGTCAACTGTTTTCCATATGAGGTGGGATGTCTCCTGGTCTGCAGTTTTTTGCTCTTCCA
GTTTGATATGTTTCTCACAGGGCATGTATATATATATGGCTTTCTTGAAGTTTTGAAGATAGCAGGAGTAGGACTTGAATCTGAATCTTATCACTTATCA
CACTCAACAAGGAAGAGTGTCAATGGACTAAACTCCCATTAG
AA sequence
>Potri.013G028450.1 pacid=42811719 polypeptide=Potri.013G028450.1.p locus=Potri.013G028450 ID=Potri.013G028450.1.v4.1 annot-version=v4.1
MYFGVKYQKQRKLHFDGVICLSPAVYLNQPFHNPCITFNEWMCFFIKVNCFPYEVGCLLVCSFLLFQFDMFLTGHVYIYGFLEVLKIAGVGLESESYHLS
HSTRKSVNGLNSH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G028450
[exp]
0 1
AT1G19530 unknown protein Potri.002G034500
[exp]
3.16 0.8979
AT5G22360 ATVAMP714 vesicle-associated membrane pr... Potri.001G219200
[exp]
4.58 0.8628
AT4G37630 CYCD5;1 cyclin d5;1 (.1.2) Potri.002G119000
[exp]
6.00 0.8388
AT2G33385 ARPC2B actin-related protein C2B (.1.... Potri.010G067100
[exp]
7.14 0.8785
AT2G36290 alpha/beta-Hydrolases superfam... Potri.010G237800
[exp]
9.79 0.8511
AT2G05940 RIPK RPM1-induced protein kinase, P... Potri.003G066300
[exp]
12.48 0.8651
AT5G52340 ATEXO70A2 exocyst subunit exo70 family p... Potri.016G071000
[exp]
13.67 0.8401
AT5G24090 ATCHIA chitinase A (.1) Potri.014G092932
[exp]
15.49 0.8252
AT1G13340 Regulator of Vps4 activity in ... Potri.010G127000
[exp]
15.49 0.8415
AT4G30420 nodulin MtN21 /EamA-like trans... Potri.006G177600
[exp]
16.24 0.8616

Potri.013G028450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.