Potri.013G031300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05020 142 / 2e-44 ACP1 acyl carrier protein 1 (.1)
AT5G27200 135 / 8e-42 ACP5 acyl carrier protein 5 (.1)
AT1G54580 134 / 2e-41 ACP2 acyl carrier protein 2 (.1)
AT1G54630 130 / 7e-40 ACP3 acyl carrier protein 3 (.1.2)
AT4G25050 124 / 3e-37 ACP4 acyl carrier protein 4 (.1.2)
AT1G65290 50 / 1e-08 MTACP2 mitochondrial acyl carrier protein 2 (.1)
AT2G44620 44 / 4e-06 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G044800 240 / 4e-83 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1)
Potri.012G105300 132 / 2e-40 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2)
Potri.015G104500 124 / 2e-37 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
Potri.006G217800 89 / 4e-23 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2)
Potri.013G084500 52 / 2e-09 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1)
Potri.019G055300 49 / 3e-08 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1)
Potri.014G044000 41 / 4e-05 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1)
Potri.002G135600 40 / 8e-05 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033836 180 / 2e-59 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2)
Lus10018986 175 / 1e-57 AT4G25050 136 / 3e-42 acyl carrier protein 4 (.1.2)
Lus10037908 142 / 1e-44 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2)
Lus10037910 141 / 4e-44 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2)
Lus10038635 139 / 2e-43 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10038636 139 / 2e-43 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
Lus10020221 52 / 2e-09 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1)
Lus10026849 54 / 5e-09 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3)
Lus10019500 44 / 3e-06 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
Lus10043348 44 / 3e-06 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0314 PP-binding PF00550 PP-binding Phosphopantetheine attachment site
Representative CDS sequence
>Potri.013G031300.1 pacid=42811950 polypeptide=Potri.013G031300.1.p locus=Potri.013G031300 ID=Potri.013G031300.1.v4.1 annot-version=v4.1
ATGGCAGCCTCCACAGGTTCTTTCATCTCCATGCAATCTCGTCCTGGAATGGCTGCATCCAGGATCTCCGGTTTGAAGCCAGTTTCACTTTCAAATCAGG
GAAGAAACACCCTGTCTTTTGGGTTGCGGTCTATGCCAGCTCGCCGCCTTCGGGTTTCATGCGCTCAGGCAAAACCTGAAACAATTGATAAGGTGTGTGA
AATAGTGAAGAAACAGTTGGCATTATCAGATGAGATCCCTGTTACTGGGGAATCAAAGTTTACAACACTTGGAGCAGATTCTCTTGATACGGTTGAGATT
GTGATGGGACTTGAGGAGGCATTTGGTATCAGCGTCGAAGAGGAGAGTGCCCAAAGCATCGCAACAGTTCAGGATGCTGCTGATCTTATTGAGAAGCTCG
TTGAGAAGAAAGATTAG
AA sequence
>Potri.013G031300.1 pacid=42811950 polypeptide=Potri.013G031300.1.p locus=Potri.013G031300 ID=Potri.013G031300.1.v4.1 annot-version=v4.1
MAASTGSFISMQSRPGMAASRISGLKPVSLSNQGRNTLSFGLRSMPARRLRVSCAQAKPETIDKVCEIVKKQLALSDEIPVTGESKFTTLGADSLDTVEI
VMGLEEAFGISVEEESAQSIATVQDAADLIEKLVEKKD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05020 ACP1 acyl carrier protein 1 (.1) Potri.013G031300 0 1
AT3G54690 SETH3 Sugar isomerase (SIS) family p... Potri.005G225700 3.60 0.8164
AT4G23820 Pectin lyase-like superfamily ... Potri.003G139100 4.00 0.8715
AT2G05790 O-Glycosyl hydrolases family 1... Potri.014G158400 4.24 0.8781
AT3G18050 unknown protein Potri.015G040900 4.24 0.8634
AT1G63850 BTB/POZ domain-containing prot... Potri.001G100900 4.89 0.8562
AT1G24620 EF hand calcium-binding protei... Potri.010G107100 5.47 0.8252
AT3G22960 PKP-ALPHA, PKP1 PLASTIDIAL PYRUVATE KINASE 1, ... Potri.009G084700 5.74 0.8208
AT3G08030 Protein of unknown function, D... Potri.001G263900 6.70 0.8521
AT3G24480 Leucine-rich repeat (LRR) fami... Potri.006G158814 7.48 0.8376
AT5G50150 Protein of Unknown Function (D... Potri.015G080300 9.79 0.8402

Potri.013G031300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.