Plant FIBer expression Database

Potri.013G032700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04945 74 / 3e-19 LCR18 low-molecular-weight cysteine-rich 18 (.1)
AT3G04943 47 / 1e-08 LCR41 low-molecular-weight cysteine-rich 41 (.1)
AT3G23165 45 / 8e-08 LCR42 low-molecular-weight cysteine-rich 42 (.1)
AT2G14935 42 / 7e-07 LCR40 low-molecular-weight cysteine-rich 40 (.1)
AT3G23167 42 / 7e-07 LCR39 low-molecular-weight cysteine-rich 39 (.1)
AT4G09647 35 / 0.0008 S locus-related glycoprotein 1 (SLR1) binding pollen coat protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.013G032700.1 pacid=42811375 polypeptide=Potri.013G032700.1.p locus=Potri.013G032700 ID=Potri.013G032700.1.v4.1 annot-version=v4.1
ATGGTGAAACTGTCTACTCTCTGTTTCCTGTTTGTCCTCTTCCTTGCCTCTGATGAGAAACTAGTGCTCATGGTAGGAGCAAGAGACTGCCACAAAGTAT
GGACCTGCAAAGGTCAAAACCGTTGCTGGGAAGACTGTAAGAATCGATATAGCGGAACGGGCCTCTGCGATTTGTACACAGCACCACCTGTTCCAAAGCA
ATGCTTCTGTGCATATAAATGCTAG
AA sequence
>Potri.013G032700.1 pacid=42811375 polypeptide=Potri.013G032700.1.p locus=Potri.013G032700 ID=Potri.013G032700.1.v4.1 annot-version=v4.1
MVKLSTLCFLFVLFLASDEKLVLMVGARDCHKVWTCKGQNRCWEDCKNRYSGTGLCDLYTAPPVPKQCFCAYKC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G04945 LCR18 low-molecular-weight cysteine-... Potri.013G032700
[exp]
0 1
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G134200
[exp]
1.73 0.9271
AT5G19875 unknown protein Potri.001G009200
[exp]
2.44 0.9280
Potri.002G075850
[exp]
3.60 0.8788
AT3G61980 serine protease inhibitor, Kaz... Potri.014G108900
[exp]
5.29 0.9111
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Potri.017G053100
[exp]
5.47 0.8755
AT3G22060 Receptor-like protein kinase-r... Potri.017G040049
[exp]
6.48 0.9038
AT2G19800 MIOX2 myo-inositol oxygenase 2 (.1) Potri.017G100200
[exp]
8.06 0.9091
AT2G24130 Leucine-rich receptor-like pro... Potri.006G181200
[exp]
9.48 0.9051
Potri.014G141600
[exp]
11.22 0.8763
AT5G25930 Protein kinase family protein ... Potri.018G057100
[exp]
11.95 0.8855

Potri.013G032700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.