Potri.013G035350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53740 38 / 0.0004 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G047550 62 / 2e-14 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.013G035350.1 pacid=42811910 polypeptide=Potri.013G035350.1.p locus=Potri.013G035350 ID=Potri.013G035350.1.v4.1 annot-version=v4.1
ATGAGCTGTCATCGAGTGCCTATAAGTACCAAAGCAAACAGCATTATACAGTTACGCAGCCGTGCGGTGGGCACAGAGCGAACTATTCTTTCGCCTTTTA
CTAAAGAATACCGTGTGCTCGCCGCAGATAGCGGCATACGCTTATTTTTGAAGGGTTCTCTTCTCTTTAGAAGAGCTCCAACAACTCTAGTTCTAAATCT
TGGATGTGCAGCGCGTGATTTTAGGACATTGCCTGGTCAAGCTAAAACTTATTTCCTTGTGTGCTTAATGTACTGTTCGTGCGCATGGCAGCACCGTTAA
AA sequence
>Potri.013G035350.1 pacid=42811910 polypeptide=Potri.013G035350.1.p locus=Potri.013G035350 ID=Potri.013G035350.1.v4.1 annot-version=v4.1
MSCHRVPISTKANSIIQLRSRAVGTERTILSPFTKEYRVLAADSGIRLFLKGSLLFRRAPTTLVLNLGCAARDFRTLPGQAKTYFLVCLMYCSCAWQHR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G035350 0 1
Potri.011G144466 6.32 0.8463
AT1G16820 vacuolar ATP synthase catalyti... Potri.005G107066 16.09 0.8366
Potri.016G051050 25.29 0.7295
AT1G16820 vacuolar ATP synthase catalyti... Potri.003G175366 30.44 0.8284
Potri.014G185660 47.01 0.7927
Potri.008G224346 48.74 0.7926
Potri.014G185876 49.69 0.7925
Potri.014G185372 50.99 0.7923
ATMG00640 ATMG00640.1, OR... hydrogen ion transporting ATP ... Potri.007G062422 51.65 0.7883
AT2G35750 unknown protein Potri.006G016001 54.49 0.7904

Potri.013G035350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.