Potri.013G035700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54500 197 / 2e-64 Rubredoxin-like superfamily protein (.1)
AT5G51010 47 / 9e-07 Rubredoxin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G049000 311 / 2e-109 AT1G54500 184 / 3e-59 Rubredoxin-like superfamily protein (.1)
Potri.015G108100 41 / 0.0001 AT5G51010 160 / 5e-51 Rubredoxin-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019005 228 / 4e-76 AT1G54500 188 / 1e-60 Rubredoxin-like superfamily protein (.1)
Lus10015945 226 / 2e-75 AT1G54500 182 / 2e-58 Rubredoxin-like superfamily protein (.1)
Lus10016735 44 / 1e-05 AT5G51010 189 / 3e-62 Rubredoxin-like superfamily protein (.1)
Lus10022430 44 / 1e-05 AT5G51010 190 / 8e-63 Rubredoxin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0045 Rubredoxin PF00301 Rubredoxin Rubredoxin
Representative CDS sequence
>Potri.013G035700.2 pacid=42812669 polypeptide=Potri.013G035700.2.p locus=Potri.013G035700 ID=Potri.013G035700.2.v4.1 annot-version=v4.1
ATGGCTTGTGCAGCCGCAAGAGCCACTTTGTCCTTCCACCTTCCACAACTTTCCCCTCCAAAATCCAGAAACCATTTCTCAAAGCTATCATTCCTCTCCA
TTCATAAACCCCAAAAGACTCATCTTTTCTCTCTACACTCCATTGATGTCTCCAGAGAAGACAAGACGCCAACTTTATCAGATTCAACCCAAACCAATCC
ACCAACAGAGTCTCCTCCCGAAGAAGAAGAAGAAGAAGAGCCAGAGTTCGATAAGAGAAGGTTGGAAGAGAAGTTTGCAGTTTTAAACACTGGGATTTAT
GAGTGTAGGTCTTGTGGCTACAAATATGATGAGGCAGTTGGTGACCCATCATATCCATTACCACCAGGGTTTCAGTTTGACAAGTTACCTGATGATTGGA
GGTGTCCAACCTGTGGGGCTGCAAAGAGTTTCTTCGAGAGTAAAAGTGTGGAGATTGCTGGGTTTGCACAGAACCAGCAGTATGGATTAGGAGGCAATGC
ACTTACTTCTGGTCAAAAGACTATTTTGATATATGGGACCTTGTTGTTCTTCTTTGTTCTGTTCTTGTCAGGGTATTTTCTGCAATAG
AA sequence
>Potri.013G035700.2 pacid=42812669 polypeptide=Potri.013G035700.2.p locus=Potri.013G035700 ID=Potri.013G035700.2.v4.1 annot-version=v4.1
MACAAARATLSFHLPQLSPPKSRNHFSKLSFLSIHKPQKTHLFSLHSIDVSREDKTPTLSDSTQTNPPTESPPEEEEEEEPEFDKRRLEEKFAVLNTGIY
ECRSCGYKYDEAVGDPSYPLPPGFQFDKLPDDWRCPTCGAAKSFFESKSVEIAGFAQNQQYGLGGNALTSGQKTILIYGTLLFFFVLFLSGYFLQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G54500 Rubredoxin-like superfamily pr... Potri.013G035700 0 1
AT3G12345 unknown protein Potri.008G047800 1.00 0.9956
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Potri.014G153000 2.00 0.9887
AT4G16410 unknown protein Potri.006G017500 3.46 0.9832
AT1G51400 Photosystem II 5 kD protein (.... Potri.001G256900 3.60 0.9749
AT1G03130 PSAD-2 photosystem I subunit D-2 (.1) Potri.008G151600 5.19 0.9841 PSAD1.2
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Potri.005G183000 6.70 0.9781
AT3G15190 chloroplast 30S ribosomal prot... Potri.001G396600 6.92 0.9806
AT3G04790 EMB3119 EMBRYO DEFECTIVE 3119, Ribose ... Potri.005G052000 7.21 0.9681
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.008G118700 7.93 0.9805
AT3G27830 RPL12-A ribosomal protein L12-A (.1) Potri.001G346100 8.36 0.9811 Pt-RPL12.6

Potri.013G035700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.