Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G28050 276 / 7e-96 Cytidine/deoxycytidylate deaminase family protein (.1.2) AT3G05300 137 / 3e-42 Cytidine/deoxycytidylate deaminase family protein (.1) AT1G68720 78 / 8e-17 ATTADA, TADA ARABIDOPSIS THALIANA TRNA ADENOSINE DEAMINASE A, tRNA arginine adenosine deaminase (.1) AT1G48175 44 / 2e-05 TAD1, EMB2191 tRNA adenosine deaminase 1, embryo defective 2191, Cytidine/deoxycytidylate deaminase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G049300 [exp] 308 / 2e-108 AT5G28050 281 / 4e-98 Cytidine/deoxycytidylate deaminase family protein (.1.2) Potri.010G003500 [exp] 263 / 7e-91 AT5G28050 267 / 2e-92 Cytidine/deoxycytidylate deaminase family protein (.1.2) Potri.008G111100 [exp] 83 / 2e-18 AT1G68720 522 / 3e-162 ARABIDOPSIS THALIANA TRNA ADENOSINE DEAMINASE A, tRNA arginine adenosine deaminase (.1) Potri.010G132600 [exp] 75 / 6e-16 AT1G68720 555 / 2e-174 ARABIDOPSIS THALIANA TRNA ADENOSINE DEAMINASE A, tRNA arginine adenosine deaminase (.1) Potri.006G075300 [exp] 50 / 6e-08 AT1G48175 227 / 1e-76 tRNA adenosine deaminase 1, embryo defective 2191, Cytidine/deoxycytidylate deaminase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015942 [exp] 250 / 6e-86 AT5G28050 288 / 3e-101 Cytidine/deoxycytidylate deaminase family protein (.1.2) Lus10001791 [exp] 245 / 5e-84 AT5G28050 288 / 7e-101 Cytidine/deoxycytidylate deaminase family protein (.1.2) Lus10034402 [exp] 77 / 3e-16 AT1G68720 436 / 2e-131 ARABIDOPSIS THALIANA TRNA ADENOSINE DEAMINASE A, tRNA arginine adenosine deaminase (.1) Lus10019153 [exp] 76 / 4e-16 AT1G68720 301 / 2e-84 ARABIDOPSIS THALIANA TRNA ADENOSINE DEAMINASE A, tRNA arginine adenosine deaminase (.1) Lus10028482 [exp] 49 / 3e-07 AT1G48175 269 / 5e-93 tRNA adenosine deaminase 1, embryo defective 2191, Cytidine/deoxycytidylate deaminase family protein (.1) Lus10009163 [exp] 46 / 3e-06 AT1G48175 265 / 1e-91 tRNA adenosine deaminase 1, embryo defective 2191, Cytidine/deoxycytidylate deaminase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0109 [poplar] [flax] CDA PF00383 [poplar] [flax] dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
Representative CDS sequence Show only first row Show all	>Potri.013G036000.2 pacid=42811697 polypeptide=Potri.013G036000.2.p locus=Potri.013G036000 ID=Potri.013G036000.2.v4.1 annot-version=v4.1 ATGGAGGATGATAATGTGATGGAAGCTGAAGACCAAACTATTTCTGTGGCATCTTCTTTTGCTGGTTATCAAGAAGCTGTTCAGGATAGAGACCATAAAT TCTTAAGTAGAGCAGTTGAAGAAGCTTATAAAGGCGTCGAATGTGGTGACGGAGGTCCATTCGGTGCTGTCGTTGTTCGAAATGATGAAGTAGTCATGAG CTGTCACAACATGGTTTTGAAAAACACTGATCCCACTGCACACGCCGAAGTTACTGTTATTAGAGAGGCATGTAAGAAGCTGAACCGAATTGAGCTCTCG GATTGCGAAATATATGCGTCCTGCGAGCCTTGTCCAATGTGCTTCGGCGCCATCCATCTCTCAAGACTCAAGAGGTTGGTTTACGGAGCTGAAGCTGAAG CAGCTATTGCAATTGGGTTTGATGATTTCATTGCTGATGCATTAAGAGGTACTGGGTTCTATCAGAAGGCTCACTTGGAGATCAAGAAAGCCGACGGTAG TGGTGCTGTTATCGCAGAACAAGTATTCGAAAAGACCAAGTCGAAATTTACCATGTATTGA
AA sequence Show only first row Show all	>Potri.013G036000.2 pacid=42811697 polypeptide=Potri.013G036000.2.p locus=Potri.013G036000 ID=Potri.013G036000.2.v4.1 annot-version=v4.1 MEDDNVMEAEDQTISVASSFAGYQEAVQDRDHKFLSRAVEEAYKGVECGDGGPFGAVVVRNDEVVMSCHNMVLKNTDPTAHAEVTVIREACKKLNRIELS DCEIYASCEPCPMCFGAIHLSRLKRLVYGAEAEAAIAIGFDDFIADALRGTGFYQKAHLEIKKADGSGAVIAEQVFEKTKSKFTMY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G28050			Cytidine/deoxycytidylate deami...		Potri.013G036000 [exp]	0	1
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Potri.017G014000 [exp]	3.60	0.8534
					Potri.005G212601 [exp]	5.29	0.7515
AT5G08240			unknown protein		Potri.007G071900 [exp]	5.47	0.8345
AT1G19980			cytomatrix protein-related (.1...		Potri.002G022200 [exp]	6.48	0.7663
AT1G15380		GLYI4	glyoxylase I 4, Lactoylglutath...		Potri.007G015100 [exp]	7.74	0.8151
AT1G55850		ATCSLE1	cellulose synthase like E1 (.1...		Potri.001G369100 [exp]	8.48	0.8229	ATCSLE1.1
AT3G51860		CAX1-LIKE, ATHC...	cation exchanger 3 (.1)		Potri.009G045800 [exp]	11.22	0.8043
AT5G15410		ATCNGC2, DND1	DEFENSE NO DEATH 1, CYCLIC NUC...		Potri.017G089900 [exp]	11.40	0.7998
AT1G80160		GLYI7	glyoxylase I 7, Lactoylglutath...		Potri.005G117000 [exp]	13.67	0.7727
AT1G31690			Copper amine oxidase family pr...		Potri.008G151900 [exp]	15.74	0.8062	DAO.3

Compare expression of checked genes

Potri.013G036000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.