Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45060 45 / 8e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72840 42 / 0.0001 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G69550 42 / 0.0002 disease resistance protein (TIR-NBS-LRR class) (.1) AT4G09430 41 / 0.0003 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G28560 40 / 0.0003 RIC7 ROP-interactive CRIB motif-containing protein 7 (.1) AT4G09360 40 / 0.0004 NB-ARC domain-containing disease resistance protein (.1) AT5G18370 40 / 0.0008 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G037599 [exp] 178 / 8e-52 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T005501 [exp] 66 / 1e-12 AT5G36930 612 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G003285 [exp] 64 / 6e-12 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T011750 [exp] 63 / 7e-12 AT5G36930 551 / 2e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G066500 [exp] 63 / 1e-11 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G007884 [exp] 60 / 1e-10 AT5G36930 654 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G004599 [exp] 59 / 3e-10 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G003942 [exp] 57 / 8e-10 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143300 [exp] 57 / 1e-09 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039850 [exp] 47 / 3e-06 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10025626 [exp] 47 / 3e-06 AT3G46530 87 / 5e-18 RECOGNITION OF PERONOSPORA PARASITICA 13, NB-ARC domain-containing disease resistance protein (.1) Lus10018616 [exp] 47 / 3e-06 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10028075 [exp] 45 / 1e-05 AT3G07040 168 / 1e-43 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) Lus10005017 [exp] 43 / 9e-05 AT4G08850 562 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G037566.1 pacid=42811070 polypeptide=Potri.013G037566.1.p locus=Potri.013G037566 ID=Potri.013G037566.1.v4.1 annot-version=v4.1 ATGAACCTGCAGAGCTGCGCTAGTCTTGAGAAATTGCCGGAGAAATTGGGTAATATGAAAGTCTTAACTGATCTTCTATTAGATGATACCGGAGTTCAGA ATCTACCCTCTTCCACTGGAATTTTGAAGAAGCTCAAAAAGTTATTGGTGCGTGGACGTTGTCCTGGTTTTAGTCTTAATAGTGCATGTCCTCGTCTTCC TTCAAATGCCTTTCACTCGAAAGAGCTTGCTATCAAGAAACAACCTTTCCTGCCACCCTCCCTCTCTGGTTTAAGCTCATTGACAACACTCGATATTAGT AATCGCCATTTATCAATCAATGATATTTCCATCAATCTTGGGAGTTTATCCTCTCTCCAGGATCTGAATTTGGCAGTAAATGATTTCTCCGAGTTGCCTG CCGGCATTGGCAACCTTGCGAAGCTAGAGAAATTGGACTTGTCATGGTGTAGAAATCTTCTGTTCATCTCAGAGATCCCCTCTGGTGGCACGTTATTGCA GATCATTGGAAAAGGTGTCAATTCAGTCAAAAACAGCGCCGGATCTGTTACTGGGTGA
AA sequence Show only first row Show all	>Potri.013G037566.1 pacid=42811070 polypeptide=Potri.013G037566.1.p locus=Potri.013G037566 ID=Potri.013G037566.1.v4.1 annot-version=v4.1 MNLQSCASLEKLPEKLGNMKVLTDLLLDDTGVQNLPSSTGILKKLKKLLVRGRCPGFSLNSACPRLPSNAFHSKELAIKKQPFLPPSLSGLSSLTTLDIS NRHLSINDISINLGSLSSLQDLNLAVNDFSELPAGIGNLAKLEKLDLSWCRNLLFISEIPSGGTLLQIIGKGVNSVKNSAGSVTG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45060			Disease resistance protein (TI...		Potri.013G037566 [exp]	0	1
AT3G46510		ATPUB13	ARABIDOPSIS THALIANA PLANT U-B...		Potri.009G029600 [exp]	19.18	0.6719
AT5G53150			DNAJ heat shock N-terminal dom...		Potri.012G001100 [exp]	23.57	0.6209
AT4G34240		ALDH3I1	aldehyde dehydrogenase 3I1 (.1...		Potri.005G069800 [exp]	26.19	0.6899
AT1G09560		GLP5	germin-like protein 5 (.1)		Potri.013G000500 [exp]	26.32	0.7317	GER1.2
AT2G44500			O-fucosyltransferase family pr...		Potri.009G022500 [exp]	61.96	0.7092
AT1G10880			Core-2/I-branching beta-1,6-N-...		Potri.013G130500 [exp]	69.05	0.6270
AT5G25050			Major facilitator superfamily ...		Potri.006G266000 [exp]	88.62	0.6969
AT1G14590			Nucleotide-diphospho-sugar tra...		Potri.012G037300 [exp]	92.46	0.6705
AT1G80160		GLYI7	glyoxylase I 7, Lactoylglutath...		Potri.004G223300 [exp]	94.81	0.6188
					Potri.014G151101 [exp]	95.92	0.6966

Compare expression of checked genes

Potri.013G037566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.