Potri.013G039500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04780 310 / 9e-110 Protein of unknown function (DUF1000) (.1)
AT2G25950 60 / 3e-11 Protein of unknown function (DUF1000) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G052100 342 / 3e-122 AT3G04780 310 / 1e-109 Protein of unknown function (DUF1000) (.1)
Potri.018G056100 53 / 7e-09 AT2G25950 366 / 5e-131 Protein of unknown function (DUF1000) (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001780 294 / 4e-103 AT3G04780 295 / 8e-104 Protein of unknown function (DUF1000) (.1)
Lus10020246 269 / 1e-91 AT3G04780 265 / 7e-90 Protein of unknown function (DUF1000) (.1)
Lus10007454 57 / 3e-10 AT2G25950 341 / 2e-120 Protein of unknown function (DUF1000) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0202 GBD PF06201 PITH PITH domain
Representative CDS sequence
>Potri.013G039500.2 pacid=42812713 polypeptide=Potri.013G039500.2.p locus=Potri.013G039500 ID=Potri.013G039500.2.v4.1 annot-version=v4.1
ATGGCTGCAGAGTCAGCTACTGTAATTCCAAGAGGCCAAGTTGATTTATTGGACTTTATTGATTTTTCTGGAGTTGAATGTCTTAACCAAAGCCCAAGCC
ACTCCCTTTCCAATGCGATCAAGCAGGGTTATAGAGAAGATGATGGTTTGAATCTAGAGAGCGATGCAGATGAGCAGTTATTGATCTATGTACCTTTCAA
TCAAGTTGTTAAACTGCATTCTATTGCCATCAAAGGACCTGAAGAAGAAGGTCCAAAGACGGTAAAACTTTTCTCAAACAAGGAGCATATGGGATTTAGT
AATGTTAATGACTACCCTCCAAGTGACACTATAGTTTTATCGCCAGATACTCTCAAGGGAAAACCTGTGGTCTTAAAATATGTAAAGTTTCAGAATGTTC
GCAGCTTGACAATATTTATCGAGGATAATCAATCAGATTCTGAGATCACGAAAGTTCACAAGATTGCTTTGTTTGGAACAACGGTGGAAACAACAGACAT
GAAAAGCCTGAAGAAGATTGAGGATCACTAA
AA sequence
>Potri.013G039500.2 pacid=42812713 polypeptide=Potri.013G039500.2.p locus=Potri.013G039500 ID=Potri.013G039500.2.v4.1 annot-version=v4.1
MAAESATVIPRGQVDLLDFIDFSGVECLNQSPSHSLSNAIKQGYREDDGLNLESDADEQLLIYVPFNQVVKLHSIAIKGPEEEGPKTVKLFSNKEHMGFS
NVNDYPPSDTIVLSPDTLKGKPVVLKYVKFQNVRSLTIFIEDNQSDSEITKVHKIALFGTTVETTDMKSLKKIEDH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G04780 Protein of unknown function (D... Potri.013G039500 0 1
AT5G20500 Glutaredoxin family protein (.... Potri.018G133400 2.23 0.9390
AT1G51650 ATP synthase epsilon chain, mi... Potri.010G250000 2.23 0.9485
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Potri.006G059300 3.46 0.9476
AT4G02620 vacuolar ATPase subunit F fami... Potri.005G217600 3.74 0.9345 VATF.1
AT5G54750 Transport protein particle (TR... Potri.001G418400 4.00 0.9398
AT4G37830 cytochrome c oxidase-related (... Potri.007G008800 4.58 0.9443
AT5G42790 ARS5, ATPSM30, ... ARSENIC TOLERANCE 5, proteasom... Potri.005G229200 6.00 0.9230
AT4G11150 TUFF, EMB2448, ... embryo defective 2448, vacuola... Potri.013G051500 6.48 0.9380
AT4G34700 CIB22, AtCIB22 B22 subunit of eukaryotic mito... Potri.009G124600 8.00 0.9167
AT3G48680 AtCAL2, GAMMACA... gamma carbonic anhydrase-like ... Potri.012G100400 8.94 0.9323

Potri.013G039500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.