Potri.013G040900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28750 97 / 5e-26 Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
AT5G52440 57 / 3e-10 HCF106 HIGH CHLOROPHYLL FLUORESCENCE 106, Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G053400 143 / 2e-44 AT5G28750 117 / 3e-34 Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Potri.015G147100 56 / 7e-10 AT5G52440 209 / 2e-67 HIGH CHLOROPHYLL FLUORESCENCE 106, Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Potri.012G144300 56 / 1e-09 AT5G52440 216 / 5e-70 HIGH CHLOROPHYLL FLUORESCENCE 106, Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006588 112 / 9e-32 AT5G28750 130 / 3e-39 Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Lus10015910 111 / 5e-31 AT5G28750 103 / 2e-28 Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Lus10039254 56 / 1e-09 AT5G52440 174 / 5e-53 HIGH CHLOROPHYLL FLUORESCENCE 106, Bacterial sec-independent translocation protein mttA/Hcf106 (.1)
Lus10027499 56 / 2e-09 AT4G14147 254 / 2e-81 protein binding (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02416 TatA_B_E mttA/Hcf106 family
Representative CDS sequence
>Potri.013G040900.3 pacid=42811365 polypeptide=Potri.013G040900.3.p locus=Potri.013G040900 ID=Potri.013G040900.3.v4.1 annot-version=v4.1
ATGAACATGGAGATCTCATCAGTAACCCTATCTCTTCCAAAGCCCCCACGTTCTCTTCCCTTCTCTTCCTCTAACTCCACCTTCTTTAACACCACTGCTT
TCTTCAACAAAACCAAGTCCTGTAACTCTTTGGTTCTTGGCAAAACAACAAGTGGAAGTCAGAGGGCTAAAAAGGGTCTAACTTGCAATGCTTTGTTTGG
TCTAGGAGTGCCTGAACTGGTTGTTATTGCTGGAGTGGCTGCTTTGGTTTTTGGGCCCAAGAAATTGCCTGAAGTGGGAAAGAGTATTGGCAAGACTGTC
AGAAGCTTCCAACAGGCAGCAAAAGAGTTTGAGTCCGAGCTTAAAAAGGAACCTGAATCTGAACCAGAGACCCCTGGAGAGCAACCTAAAGCAATCATTG
AAGAGAAGAAACAAGACGTCGAAGTCTCTAGCTCTAAGGAGAGAGTGTATGAGTTTGTAGACATATGTAGTTGCTACGTTTTCTCTAGCCCTAAGCTGTT
GTGTCCTCTTCTTTAG
AA sequence
>Potri.013G040900.3 pacid=42811365 polypeptide=Potri.013G040900.3.p locus=Potri.013G040900 ID=Potri.013G040900.3.v4.1 annot-version=v4.1
MNMEISSVTLSLPKPPRSLPFSSSNSTFFNTTAFFNKTKSCNSLVLGKTTSGSQRAKKGLTCNALFGLGVPELVVIAGVAALVFGPKKLPEVGKSIGKTV
RSFQQAAKEFESELKKEPESEPETPGEQPKAIIEEKKQDVEVSSSKERVYEFVDICSCYVFSSPKLLCPLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G28750 Bacterial sec-independent tran... Potri.013G040900 0 1
AT3G15190 chloroplast 30S ribosomal prot... Potri.001G396600 4.00 0.9739
AT4G24700 unknown protein Potri.015G084200 5.09 0.9734
AT3G45050 unknown protein Potri.009G008400 7.87 0.9480
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.008G118700 8.48 0.9710
AT1G27385 unknown protein Potri.003G172000 9.16 0.9603
AT3G54210 Ribosomal protein L17 family p... Potri.016G143100 9.79 0.9697
AT1G35680 RPL21C chloroplast ribosomal protein ... Potri.019G083400 11.22 0.9638 Pt-RPL21.3
AT3G12345 unknown protein Potri.010G213600 11.40 0.9696
AT1G16080 unknown protein Potri.003G185501 15.58 0.9616
AT5G52960 unknown protein Potri.012G033700 16.52 0.9627

Potri.013G040900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.