Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04750 169 / 5e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G43790 140 / 2e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G46790 137 / 1e-38 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G05240 136 / 3e-38 MEF19 mitochondrial editing factor 19 (.1) AT1G20230 136 / 6e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G34160 134 / 1e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G26782 134 / 2e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49170 134 / 3e-37 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G33990 133 / 6e-37 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G44230 130 / 4e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G053600 [exp] 243 / 3e-78 AT3G04750 759 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G065500 [exp] 150 / 2e-43 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G220300 [exp] 144 / 1e-40 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G223900 [exp] 137 / 6e-39 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G258766 [exp] 137 / 1e-38 AT1G06150 705 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Potri.004G125500 [exp] 136 / 3e-38 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G058900 [exp] 136 / 5e-38 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G081700 [exp] 136 / 6e-38 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G012600 [exp] 135 / 6e-38 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000117 [exp] 144 / 4e-42 AT4G21065 404 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10006628 [exp] 143 / 8e-42 AT4G21065 399 / 7e-137 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10039388 [exp] 143 / 9e-41 AT5G43790 506 / 8e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030053 [exp] 143 / 2e-40 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030225 [exp] 137 / 1e-39 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005987 [exp] 138 / 3e-39 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10033026 [exp] 139 / 7e-39 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017446 [exp] 137 / 5e-38 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013149 [exp] 136 / 5e-38 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028837 [exp] 132 / 1e-37 AT1G11290 650 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.013G041150.1 pacid=42812597 polypeptide=Potri.013G041150.1.p locus=Potri.013G041150 ID=Potri.013G041150.1.v4.1 annot-version=v4.1 ATGATAACAGGATTTGCTTTCCATGGTTATGGAAGCAAGGTTTTGCAACTATGGAAGATGCAGGAAGATGCAAGTCCAGACAACGTGACTTTTGTTTCTG TTCTTTCAGCTTGTAGCCATAGTGGACTTGCAGATCAAGGGATTAAAACTTTCAGTTCTGTGAAAGACCATGGCATTGAACCAGTAGTCGAGCACTATGG ATGTTTGGTAGATCTTTTAGCACGACCAGGGAGGTTGTCTGAGGAAAAAGATATCATTAATCAGATGCTCATGAAACCAAGTCGTTCCATCTGGGGGGGA ATACTAAATGCTTGCCAAGTTCAAGAGGATGTGGAAACGGCGGAGATAGCTTCCAGGGAGTCGCTAAATTTAGACCCTGAGGAAGAAGGTGGATACACGT TGCTGTCTAACATAAATGCAGCTAGTGGAAGGTGA
AA sequence Show only first row Show all	>Potri.013G041150.1 pacid=42812597 polypeptide=Potri.013G041150.1.p locus=Potri.013G041150 ID=Potri.013G041150.1.v4.1 annot-version=v4.1 MITGFAFHGYGSKVLQLWKMQEDASPDNVTFVSVLSACSHSGLADQGIKTFSSVKDHGIEPVVEHYGCLVDLLARPGRLSEEKDIINQMLMKPSRSIWGG ILNACQVQEDVETAEIASRESLNLDPEEEGGYTLLSNINAASGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04750			Tetratricopeptide repeat (TPR)...		Potri.013G041150 [exp]	0	1
					Potri.014G052766 [exp]	4.89	0.6924
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Potri.018G110200 [exp]	38.47	0.6027	ATNAP10.1
AT2G02240		MEE66	maternal effect embryo arrest ...		Potri.006G267000 [exp]	89.87	0.6027

Compare expression of checked genes

Potri.013G041150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.