Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	IAA8.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43700 239 / 3e-81 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT1G04240 233 / 1e-78 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT3G23030 200 / 6e-66 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT4G14560 193 / 5e-63 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1) AT1G04250 167 / 3e-52 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT3G04730 167 / 4e-52 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT3G23050 165 / 3e-51 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT4G14550 165 / 3e-51 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT4G29080 165 / 2e-50 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT2G22670 157 / 4e-47 AUX_IAA IAA8 indoleacetic acid-induced protein 8 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G053800 [exp] 363 / 1e-129 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G218200 [exp] 266 / 2e-91 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 257 / 4e-88 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G078400 [exp] 249 / 9e-85 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161100 [exp] 246 / 2e-83 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161200 [exp] 178 / 3e-56 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.002G044900 [exp] 173 / 3e-54 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 171 / 2e-53 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.005G053900 [exp] 169 / 1e-52 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039413 [exp] 253 / 3e-86 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039488 [exp] 249 / 6e-85 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 244 / 2e-82 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10002723 [exp] 231 / 2e-77 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10024853 [exp] 222 / 1e-73 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10018764 [exp] 219 / 9e-73 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10028222 [exp] 182 / 3e-57 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10039414 [exp] 166 / 3e-51 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10042929 [exp] 167 / 1e-50 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10019241 [exp] 162 / 2e-49 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.013G041300.1 pacid=42812233 polypeptide=Potri.013G041300.1.p locus=Potri.013G041300 ID=Potri.013G041300.1.v4.1 annot-version=v4.1 ATGGAATTTGAGAGAGATCTTAATCTTGATGCAACAGAGCTTAGGTTAGGCCTCCCCGGCACTGCCACAAAACAGTCAGAGAAGCAAACACCTAACTCAA ATCTTGCCAAGAGCAACAAAAGATCATTGCCTGACATGAATGAAGAGCCCGCAGGATCATCAAGGGAAAATTCTAGCACTGTCTCATCAAATGACAAAAA AAGCCATGACCAAGAAACTGCTCCACCCATCAAGGCACAAGTGGTAGGGTGGCCACCAATCAGATCTTACAGGAAAAACTGTCTACAAGCAAAGAAACTA GAGGCTGAAGCTGCTGGACTTTACGTGAAAGTTAGCATGGATGGTGCTCCTTATCTCAGAAAGATTGATTTGAAGGTTTACAAAGGATATCCAGAACTCC TTAAGGCCTTAGAAGAGATGTTCAAATCCAAAGTTGGTGAGTATTCGGAGAGGGAAGGGTATAATGGATCAGAACATGTACCAACGTATGAAGACAAAGA TGGAGATTGGATGTTGGTTGGAGATGTTCCATGGGATATGTTCATCAATTCATGTAAGAGGCTGAGAATCATGAAAGAGTCAGAAGCTAGAGGTTTGGGT TGTGCTGTGTAA
AA sequence Show only first row Show all	>Potri.013G041300.1 pacid=42812233 polypeptide=Potri.013G041300.1.p locus=Potri.013G041300 ID=Potri.013G041300.1.v4.1 annot-version=v4.1 MEFERDLNLDATELRLGLPGTATKQSEKQTPNSNLAKSNKRSLPDMNEEPAGSSRENSSTVSSNDKKSHDQETAPPIKAQVVGWPPIRSYRKNCLQAKKL EAEAAGLYVKVSMDGAPYLRKIDLKVYKGYPELLKALEEMFKSKVGEYSEREGYNGSEHVPTYEDKDGDWMLVGDVPWDMFINSCKRLRIMKESEARGLG CAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Potri.013G041300 [exp]	0	1	IAA8.2
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Potri.013G041400 [exp]	2.82	0.7477
AT5G17410			Spc97 / Spc98 family of spindl...		Potri.010G180700 [exp]	6.32	0.7465
AT5G57123			unknown protein		Potri.018G140500 [exp]	6.48	0.7148
AT1G73590		ATPIN1, PIN1	ARABIDOPSIS THALIANA PIN-FORME...		Potri.016G035300 [exp]	8.60	0.7690	PIN2,Pt-PIN2.3
AT5G09800			ARM repeat superfamily protein...		Potri.005G057500 [exp]	8.77	0.7418
AT1G67570			Protein of unknown function (D...		Potri.012G094700 [exp]	9.27	0.7629
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Potri.001G105100 [exp]	9.48	0.7557
AT5G50150			Protein of Unknown Function (D...		Potri.012G088300 [exp]	11.22	0.7258
AT5G02440			unknown protein		Potri.001G238900 [exp]	16.24	0.7427
AT2G41370		BOP2	BLADE ON PETIOLE2, Ankyrin rep...		Potri.016G040500 [exp]	18.70	0.6840

Compare expression of checked genes

Potri.013G041300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.