Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PR4.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04720 266 / 3e-91 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-related 4 (.1) AT3G12500 61 / 8e-11 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1) AT2G43570 44 / 2e-05 CHI "chitinase, putative", chitinase, putative (.1) AT2G43620 44 / 2e-05 Chitinase family protein (.1) AT3G54420 40 / 0.0006 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT2G43610 40 / 0.0008 Chitinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G041900 [exp] 291 / 1e-101 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041700 [exp] 283 / 2e-98 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.005G054000 [exp] 263 / 1e-90 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.009G142300 [exp] 64 / 4e-12 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142000 [exp] 64 / 5e-12 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182000 [exp] 61 / 5e-11 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141700 [exp] 59 / 2e-10 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141800 [exp] 51 / 1e-07 AT3G12500 351 / 9e-121 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182100 [exp] 44 / 2e-05 AT3G12500 306 / 7e-103 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006552 [exp] 267 / 7e-92 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003265 [exp] 208 / 6e-69 AT3G04720 202 / 8e-67 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006557 [exp] 199 / 2e-65 AT3G04720 191 / 2e-62 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006556 [exp] 191 / 1e-62 AT3G04720 186 / 1e-60 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003264 [exp] 186 / 1e-60 AT3G04720 181 / 1e-58 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003262 [exp] 161 / 3e-51 AT3G04720 154 / 2e-48 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10020252 [exp] 142 / 4e-43 AT3G04720 135 / 4e-40 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10001774 [exp] 139 / 9e-42 AT3G04720 125 / 2e-36 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003588 [exp] 135 / 2e-40 AT3G04720 128 / 1e-37 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003266 [exp] 95 / 4e-25 AT3G04720 89 / 2e-23 HEVEIN-LIKE, pathogenesis-related 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00187 [poplar] [flax] Chitin_bind_1 Chitin recognition protein CL0199 [poplar] [flax] DPBB PF00967 [poplar] [flax] Barwin Barwin family
Representative CDS sequence Show only first row Show all	>Potri.013G041600.1 pacid=42811590 polypeptide=Potri.013G041600.1.p locus=Potri.013G041600 ID=Potri.013G041600.1.v4.1 annot-version=v4.1 ATGAGGAGGGTTTATGATACATTCTTGATCGTTCTGTTATGTCTAATAGCAGGTGCTACTGGTGAGCAATGTGGTAAGCAAGCGGGTGGCCAGACCTGCC CTAATAACCTGTGTTGTAGTCAATATGGGTGGTGTGGAGATACTGATGATTATTGTTCGCCGTCCAAGAACTGTCAAAGCAATTGCAAGGGTGGCGGCGG TGAAAGTGCGTCAAATGTGCGTGCCACATATCACCTGTACAATCCACAAGATCATGGATGGGACTTGAATGCAGTCAGTGCTTATTGTTCTACATGGGAT GCTAGCAAGCCTTATTCTTGGCGAAGTAAATATGGCTGGACTGCTTTTTGTGGCCCGGCTGGTCCTAGAGGCCAGGCTTCTTGTGGCAAGTGCTTGAGGG TGACAAATACAAGGACAGGAGCTCAAACAACAGCGAGGATTGTGGATCAATGTAGCAATGGAGGACTAGATTTGGACGTGAACGTTTTTCGCACAATAGA CACAGACGGAGATGGATACGCAAAAGGGCACCTCATTGTGAACTACCAGTTCGTTGGTTGTGGTGATTCTATCAACAGCCCTAAACCTCTGCTCTCTATC ATCGATGATCAATAG
AA sequence Show only first row Show all	>Potri.013G041600.1 pacid=42811590 polypeptide=Potri.013G041600.1.p locus=Potri.013G041600 ID=Potri.013G041600.1.v4.1 annot-version=v4.1 MRRVYDTFLIVLLCLIAGATGEQCGKQAGGQTCPNNLCCSQYGWCGDTDDYCSPSKNCQSNCKGGGGESASNVRATYHLYNPQDHGWDLNAVSAYCSTWD ASKPYSWRSKYGWTAFCGPAGPRGQASCGKCLRVTNTRTGAQTTARIVDQCSNGGLDLDVNVFRTIDTDGDGYAKGHLIVNYQFVGCGDSINSPKPLLSI IDDQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Potri.013G041600 [exp]	0	1	Pt-PR4.1
					Potri.004G067750 [exp]	1.41	0.8925
AT3G14130			Aldolase-type TIM barrel famil...		Potri.003G069300 [exp]	2.23	0.8599
					Potri.006G037801 [exp]	3.46	0.8850
					Potri.005G091901 [exp]	4.47	0.8426
AT2G41380			S-adenosyl-L-methionine-depend...		Potri.016G039051 [exp]	4.58	0.8518
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Potri.004G182000 [exp]	4.89	0.8432	CHIA5.3
AT4G11650		ATOSM34	osmotin 34 (.1)		Potri.001G102400 [exp]	7.54	0.7773
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Potri.007G135100 [exp]	9.00	0.8426
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.008G155100 [exp]	11.74	0.7587
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Potri.006G176800 [exp]	11.95	0.8265

Compare expression of checked genes

Potri.013G041600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.