HON902 (Potri.013G042700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol HON902
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30620 66 / 2e-13 winged-helix DNA-binding transcription factor family protein (.1.2)
AT1G06760 61 / 4e-11 winged-helix DNA-binding transcription factor family protein (.1)
AT2G18050 57 / 4e-10 HIS1-3 histone H1-3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G162300 75 / 9e-17 AT2G30620 76 / 2e-17 winged-helix DNA-binding transcription factor family protein (.1.2)
Potri.005G219800 73 / 2e-15 AT1G06760 89 / 1e-20 winged-helix DNA-binding transcription factor family protein (.1)
Potri.010G076800 70 / 7e-15 AT1G06760 77 / 4e-17 winged-helix DNA-binding transcription factor family protein (.1)
Potri.002G043100 69 / 7e-14 AT2G30620 92 / 3e-22 winged-helix DNA-binding transcription factor family protein (.1.2)
Potri.005G116600 64 / 1e-12 AT2G18050 117 / 3e-33 histone H1-3 (.1.2)
Potri.007G014200 54 / 4e-09 AT2G18050 109 / 2e-30 histone H1-3 (.1.2)
Potri.002G199900 54 / 7e-09 AT2G30620 84 / 4e-20 winged-helix DNA-binding transcription factor family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006561 82 / 7e-19 AT2G30620 115 / 1e-31 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10005535 82 / 8e-19 AT2G30620 124 / 8e-35 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10006562 77 / 1e-17 AT2G30620 112 / 2e-31 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10005534 65 / 1e-12 AT2G30620 116 / 9e-32 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10025968 59 / 2e-10 AT2G18050 132 / 6e-39 histone H1-3 (.1.2)
Lus10022001 59 / 2e-10 AT2G30620 115 / 3e-31 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10042541 59 / 2e-10 AT2G30620 121 / 3e-33 winged-helix DNA-binding transcription factor family protein (.1.2)
Lus10014267 51 / 4e-08 AT2G18050 102 / 1e-28 histone H1-3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF00538 Linker_histone linker histone H1 and H5 family
Representative CDS sequence
>Potri.013G042700.1 pacid=42810903 polypeptide=Potri.013G042700.1.p locus=Potri.013G042700 ID=Potri.013G042700.1.v4.1 annot-version=v4.1
ATGTCTGCAACAACCAAAGCCAAGAAACCCAAATCCCCTCGCGCTTATCCATCTTTCCACGTGATGATTAGTGATGCAATTTTGACGTTGAAGGAGAGGA
CAGGATCGAGCCAGTATGCGATAACGAAGTTTCTAGAAGAAAAGCACAAGAAAAAGCTGCCTGCTAATTTCAGAAAACTTTTATTAGTTCAACTCAAGAA
ACTTGTTGCTTCTCAGAAGCTTGTCAAAGTCAAGAACTCCTTCAAACTACCTTCGGCTCGGCCTGCTCCTGCTAAGAAACCACAAGCCACTAAGGCCAAA
ACTGCCAAGTCGAAGCTGAAAAAGATAACAACCACTGCCAAGCCGAAGCCGAGAAAGATAGCGACCCCTGCCAAGCCAAAGCCGAAGCCGAGAAAGATAG
CGACCCCTGCCAAGCCAAAGCCGAAGCCAAAAGCCAATGTTGCAGCCAAGCCGAAGGTGAAAACTCCTGTGAAAGCGAAGCCGGCTGCTAAGCCAAAGAA
GGCGATTGCAAAACCAACTAAGGTAGCGAGGACAAAGAAGGTTGCATCACCGGGGAAGAAGGCTGTAGCGGTGAAGCTCAAGAGTGTGAAGAGAAAAGCA
GCGAAGAAGTGA
AA sequence
>Potri.013G042700.1 pacid=42810903 polypeptide=Potri.013G042700.1.p locus=Potri.013G042700 ID=Potri.013G042700.1.v4.1 annot-version=v4.1
MSATTKAKKPKSPRAYPSFHVMISDAILTLKERTGSSQYAITKFLEEKHKKKLPANFRKLLLVQLKKLVASQKLVKVKNSFKLPSARPAPAKKPQATKAK
TAKSKLKKITTTAKPKPRKIATPAKPKPKPRKIATPAKPKPKPKANVAAKPKVKTPVKAKPAAKPKKAIAKPTKVARTKKVASPGKKAVAVKLKSVKRKA
AKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G30620 winged-helix DNA-binding trans... Potri.013G042700 0 1 HON902
AT2G47710 Adenine nucleotide alpha hydro... Potri.002G193800 1.73 0.8381
AT3G02470 SAMDC S-adenosylmethionine decarboxy... Potri.018G101500 4.47 0.8318
AT1G55340 Protein of unknown function (D... Potri.006G233100 6.32 0.8171
AT5G22460 alpha/beta-Hydrolases superfam... Potri.004G203700 7.74 0.8310
AT5G02460 DOF AtDof5. 1 Dof-type zinc finger DNA-bindi... Potri.009G029500 8.24 0.8366
Potri.009G149000 9.16 0.8399
AT4G31550 WRKY ATWRKY11, WRKY1... WRKY DNA-binding protein 11 (.... Potri.018G008500 10.63 0.8417 Pt-WRKY11.1
AT1G79840 HD GL2 GLABRA 2, HD-ZIP IV family of ... Potri.003G052400 11.48 0.8141 GL2.1
AT5G49660 XIP1 XYLEM INTERMIXED WITH PHLOEM 1... Potri.002G111700 13.96 0.8087
AT1G28330 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1,... Potri.004G047100 14.38 0.7725

Potri.013G042700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.