Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06620 126 / 7e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03410 112 / 2e-30 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06645 110 / 9e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04350 109 / 2e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G25450 108 / 3e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03400 108 / 4e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 107 / 1e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G61400 106 / 4e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06650 105 / 4e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G30840 103 / 3e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G045000 [exp] 204 / 6e-66 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 132 / 5e-38 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G165400 [exp] 128 / 3e-36 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073166 [exp] 122 / 3e-34 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073232 [exp] 122 / 5e-34 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.004G083100 [exp] 120 / 2e-33 AT1G04350 287 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 117 / 2e-32 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 117 / 4e-32 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 115 / 2e-31 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022191 [exp] 122 / 5e-34 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022195 [exp] 114 / 5e-31 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023499 [exp] 113 / 1e-30 AT1G06620 400 / 2e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 113 / 1e-30 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021203 [exp] 112 / 2e-30 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10040382 [exp] 112 / 2e-30 AT1G06620 411 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037796 [exp] 112 / 3e-30 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022197 [exp] 112 / 3e-30 AT1G06620 434 / 6e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022192 [exp] 111 / 5e-30 AT5G43440 372 / 1e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10022196 [exp] 110 / 1e-29 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.013G045101.1 pacid=42811093 polypeptide=Potri.013G045101.1.p locus=Potri.013G045101 ID=Potri.013G045101.1.v4.1 annot-version=v4.1 ATGCCGTCAGACTTGGTTCAAAATGGATCTGTCTGTGATATAGAAAAAGAATTACAGGCTTTTGACGAATCAAAAGCTGGTGTCAAGGGACTTGTAGACG CTGGGATAATTAAAACTCCTCCCTTCTTTGTGGTACTAGAAAGTGAAGTCTCTTGCCAACCAAGTCCAGCCCATTTTCATATTCCTGTCATAGACCTGAA AGGCATTCATGAAGATGATGTTCGACGTAGAGAAATTGTTGAGCAGATGTGCAATGCTTCAGAGACATGGGGGTTCTTTCAGGTTGTGAATCATGGTATT TCAAAAAATGTCATGGAGGGAATGGTTCAGGGAGTGAAGGGAATTCATAAGGAAAAGAATGAAGTGAAAATGGAATATTATACAAGGGACACGAAGAAGA AGGTGACTTGCACTAGCAATTCTCTCCTTTAG
AA sequence Show only first row Show all	>Potri.013G045101.1 pacid=42811093 polypeptide=Potri.013G045101.1.p locus=Potri.013G045101 ID=Potri.013G045101.1.v4.1 annot-version=v4.1 MPSDLVQNGSVCDIEKELQAFDESKAGVKGLVDAGIIKTPPFFVVLESEVSCQPSPAHFHIPVIDLKGIHEDDVRRREIVEQMCNASETWGFFQVVNHGI SKNVMEGMVQGVKGIHKEKNEVKMEYYTRDTKKKVTCTSNSLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.013G045101 [exp]	0	1
AT1G77230			Tetratricopeptide repeat (TPR)...		Potri.005G184001 [exp]	3.31	0.8337
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.002G010466 [exp]	13.41	0.7384
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Potri.019G050950 [exp]	16.00	0.7772
AT1G14205			Ribosomal L18p/L5e family prot...		Potri.008G087100 [exp]	25.49	0.7618
AT3G22380		TIC	time for coffee (.1.2)		Potri.010G089700 [exp]	41.78	0.7559
AT3G13040	GARP		myb-like HTH transcriptional r...		Potri.007G003200 [exp]	52.82	0.7248
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.002G010532 [exp]	56.12	0.7080
					Potri.004G216601 [exp]	67.56	0.6804
AT2G28550	AP2_ERF	TOE1, RAP2.7	TARGET OF EARLY ACTIVATION TAG...		Potri.010G216200 [exp]	81.15	0.6707
AT5G05680		EMB2789, MOS7	MODIFIER OF SNC1,7, EMBRYO DEF...		Potri.008G067600 [exp]	81.19	0.6775

Compare expression of checked genes

Potri.013G045101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.