Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79870 163 / 4e-50 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT1G12550 89 / 2e-21 HPR3 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT2G45630 81 / 2e-19 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT3G19480 49 / 4e-07 D-3-phosphoglycerate dehydrogenase (.1) AT1G17745 49 / 6e-07 PGDH D-3-phosphoglycerate dehydrogenase (.1.2) AT4G34200 47 / 1e-06 EDA9 embryo sac development arrest 9, D-3-phosphoglycerate dehydrogenase (.1) AT1G17744 42 / 3e-05 unknown protein AT1G68010 40 / 0.0005 ATHPR1, HPR hydroxypyruvate reductase (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G183700 [exp] 276 / 3e-94 AT1G79870 404 / 3e-142 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.003G052700 [exp] 173 / 7e-54 AT1G79870 443 / 7e-158 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151200 [exp] 86 / 2e-20 AT2G45630 382 / 3e-133 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151100 [exp] 86 / 4e-20 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073500 [exp] 83 / 4e-19 AT2G45630 377 / 4e-131 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073400 [exp] 81 / 4e-18 AT2G45630 405 / 2e-141 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G113250 [exp] 74 / 4e-16 AT1G12550 340 / 9e-117 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Potri.003G119000 [exp] 71 / 8e-15 AT2G45630 327 / 2e-111 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G022800 [exp] 49 / 6e-07 AT3G19480 860 / 0.0 D-3-phosphoglycerate dehydrogenase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025795 [exp] 187 / 2e-59 AT1G79870 438 / 6e-156 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10035867 [exp] 185 / 2e-58 AT1G79870 431 / 8e-153 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10035866 [exp] 162 / 2e-49 AT1G79870 466 / 6e-167 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025796 [exp] 160 / 5e-49 AT1G79870 466 / 1e-166 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10037552 [exp] 152 / 2e-45 AT1G79870 410 / 6e-145 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10011442 [exp] 115 / 4e-33 AT1G79870 117 / 1e-32 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10036536 [exp] 84 / 1e-20 AT2G45630 156 / 1e-48 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10040679 [exp] 75 / 3e-16 AT2G45630 124 / 1e-34 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10006708 [exp] 73 / 2e-15 AT1G12550 358 / 4e-124 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10036537 [exp] 73 / 2e-15 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0325 [poplar] [flax] Form_Glyc_dh PF00389 [poplar] [flax] 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
Representative CDS sequence Show only first row Show all	>Potri.013G046150.1 pacid=42812517 polypeptide=Potri.013G046150.1.p locus=Potri.013G046150 ID=Potri.013G046150.1.v4.1 annot-version=v4.1 ATGGAAACGAACCACCACACAACCCAACAGACAGAAAAGGAGAAGAACCCTAACCTTGAAAAAATCTTAGGCATAAAAATGAGGTCCATTGGAGTCCTCA TGACTTGTCCGATGGACAAATACCTAGAACAACATCTAGAAACCCACTTTAATCTCTTCAAACTATGGCACTGCAACTCTTCAATAACTGAATTCTTGAA AACAGATCAAGGAAACACAATCAGAGCAGTAGTAGGTAACACTGAGATTGGTGAAGATGTTGAACTAATTGCGTCATTGCCAAGTTTAGAAATTGTTGCC AATTACAGTGTAGGATTGGATAAAATTGATTTGAGAAAGTGTGAAGAGAAAGGGATTAGAGTTGCTAATACCCCTGATGTTTTGACTGATGATGTTGCTG ACTTAGCAATTTGGTTGATATTGAGGGTTTTGAGGAGGATTTGTGCTTCTGATGCTTACGTCAGGATTGGCAAGTGGAAGGATGCTGATTTTGGATTGGC AACAAAGGTCTGTTAA
AA sequence Show only first row Show all	>Potri.013G046150.1 pacid=42812517 polypeptide=Potri.013G046150.1.p locus=Potri.013G046150 ID=Potri.013G046150.1.v4.1 annot-version=v4.1 METNHHTTQQTEKEKNPNLEKILGIKMRSIGVLMTCPMDKYLEQHLETHFNLFKLWHCNSSITEFLKTDQGNTIRAVVGNTEIGEDVELIASLPSLEIVA NYSVGLDKIDLRKCEEKGIRVANTPDVLTDDVADLAIWLILRVLRRICASDAYVRIGKWKDADFGLATKVC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79870			D-isomer specific 2-hydroxyaci...		Potri.013G046150 [exp]	0	1
AT4G12570		UPL5	ubiquitin protein ligase 5 (.1...		Potri.016G059800 [exp]	1.41	0.9171
AT4G23010		ATUTR2, UTR2	UDP-galactose transporter 2 (....		Potri.003G121000 [exp]	1.73	0.8984
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Potri.016G089000 [exp]	3.16	0.8892
AT4G20325			unknown protein		Potri.006G280600 [exp]	3.74	0.9128
AT5G58130		ROS3	REPRESSOR OF SILENCING 3, RNA-...		Potri.018G151300 [exp]	5.19	0.8697
AT4G08455			BTB/POZ domain-containing prot...		Potri.002G077000 [exp]	5.29	0.8512
AT1G52080		AR791	actin binding protein family (...		Potri.003G047200 [exp]	5.65	0.8951
AT3G07870			F-box and associated interacti...		Potri.001G396800 [exp]	5.91	0.8715
					Potri.009G170400 [exp]	6.32	0.8707
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.017G150100 [exp]	6.63	0.8609

Compare expression of checked genes

Potri.013G046150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.