Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-CDC20.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33270 766 / 0 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 749 / 0 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT5G27080 620 / 0 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G26900 616 / 0 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 601 / 0 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27945 458 / 8e-160 Transducin/WD40 repeat-like superfamily protein (.1) AT4G22910 332 / 1e-109 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT5G13840 330 / 1e-108 FZR3 FIZZY-related 3 (.1.2) AT4G11920 319 / 1e-104 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT5G08390 78 / 4e-15 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G021800 [exp] 883 / 0 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G118400 [exp] 781 / 0 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 627 / 0 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 357 / 2e-119 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.010G202100 [exp] 336 / 4e-111 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.008G057500 [exp] 325 / 1e-106 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.001G112700 [exp] 322 / 2e-105 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.003G119500 [exp] 320 / 8e-105 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.009G058000 [exp] 77 / 7e-15 AT5G52820 811 / 0.0 WD-40 repeat family protein / notchless protein, putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006853 [exp] 728 / 0 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 722 / 0 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 719 / 0 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 611 / 0 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 597 / 0 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 533 / 0 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037595 [exp] 365 / 3e-126 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10043009 [exp] 344 / 1e-114 AT4G33270 344 / 1e-114 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10040282 [exp] 346 / 1e-111 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2) Lus10024482 [exp] 319 / 3e-104 AT4G22910 733 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00400 [poplar] [flax] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Potri.013G048900.1 pacid=42811099 polypeptide=Potri.013G048900.1.p locus=Potri.013G048900 ID=Potri.013G048900.1.v4.1 annot-version=v4.1 ATGGATGCAGGGTCTATTAACTCTTCTTCAAGCTTGAAAGCACAATCTCGTTTCCCTCTTCAACAGCAGTTTCTTCCCAGAATGAACTCTAAAGAAAACC TGGATAGATTTATTCCAAACCGGTCAGCCATGGATATGGATTATGCCCATTTCATGTTAACAGAAGGGAGAAAAGGGAAAGAGAATCCAACAGTGAACTC ACCGTCAAGAGAGGCTTACAGGAAGCAACTTGCTGAATCCTTGAACATGAACCGAACTCGAATTCTAGCTTTCAAGAACAAGCCTCCTGCACCTGTCGAG TTGATGCCTCAAGACCACTCTCATCACCACCACCAGCCCAAAACCGCCAAGCCTCGCCGACATATTCCTCAGACTTCTGAGAGGACACTGGATGCACCGG ATCTTGTGGATGATTTCTACCTCAACTTATTGGATTGGGGCAGCAGCAATGTTTTAGCCATAGCTCTTGGAAGCACTGTTTATTTGTGGGATGCTTCAGA CGGTTCCACCTCAGAATTGGTCACGGTTGATGATGAAGATGGACCCATTACCAGTGTCAATTGGGCTCCTGATGGACGCCATATTGCCATAGGCTTGAAC AATTCTCACATACAGTTATGGGATTCTGCTTCCAATAGACAGCTAAGAACATTGAAAGGAGGCCACAGATCGCGAGTGGGGTCATTGGCATGGAACAATC ACATCCTGACAACAGGAGGAATGGATGGTCAAATCATTAACAATGACGTGAGAATTAGATCACACATTGTTGAGACTTACAGAGGTCATACACAGGAGGT TTGTGGGCTTAAATGGTCCGCTTCAGGTCAACAATTAGCAAGTGGAGGCAATGATAATCTAATTCATATATGGGATAGATCTACAGCATTATCAAACTCA GCAACACAGTGGCTTCACAGGCTTGAGGACCATACTTCAGCAGTGAAAGCCCTGGCATGGTGTCCTTTCCAAGGGAATTTGCTAGCCTCTGGAGGAGGTG GAGGAGATAAGAGTATTAAGTTTTGGAATACACATACAGGTGCCTGCTTGAACTCGATTGATACCGGATCTCAGGTTTGTTCTCTTTTGTGGAACAAGAA TGAAAGGGAACTACTTAGCTCTCATGGGTTTACTCAGAATCAACTCACTGTTTGGAAATATCCATCAATGGTGAAAATGGCAGAGCTCACTGGCCATACT TCTAGAGTCCTTTACATGGCTCAGAGTCCGGATGGTTGCACAGTGGCAACAGCAGCAGGAGATGAAACGTTAAGATTTTGGAATGTTTTTGGAGTTCCAG AAGTGGCTGCTAAAGCTGCTCCTAAAGCAAATCCCGAGCCATTTTCTCACTTGAATCGCCTTCGCTGA
AA sequence Show only first row Show all	>Potri.013G048900.1 pacid=42811099 polypeptide=Potri.013G048900.1.p locus=Potri.013G048900 ID=Potri.013G048900.1.v4.1 annot-version=v4.1 MDAGSINSSSSLKAQSRFPLQQQFLPRMNSKENLDRFIPNRSAMDMDYAHFMLTEGRKGKENPTVNSPSREAYRKQLAESLNMNRTRILAFKNKPPAPVE LMPQDHSHHHHQPKTAKPRRHIPQTSERTLDAPDLVDDFYLNLLDWGSSNVLAIALGSTVYLWDASDGSTSELVTVDDEDGPITSVNWAPDGRHIAIGLN NSHIQLWDSASNRQLRTLKGGHRSRVGSLAWNNHILTTGGMDGQIINNDVRIRSHIVETYRGHTQEVCGLKWSASGQQLASGGNDNLIHIWDRSTALSNS ATQWLHRLEDHTSAVKALAWCPFQGNLLASGGGGGDKSIKFWNTHTGACLNSIDTGSQVCSLLWNKNERELLSSHGFTQNQLTVWKYPSMVKMAELTGHT SRVLYMAQSPDGCTVATAAGDETLRFWNVFGVPEVAAKAAPKANPEPFSHLNRLR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Potri.013G048900 [exp]	0	1	Pt-CDC20.4
AT5G56120			unknown protein		Potri.001G470800 [exp]	1.00	0.9806
AT5G13840		FZR3	FIZZY-related 3 (.1.2)		Potri.010G202100 [exp]	1.41	0.9766
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Potri.019G021800 [exp]	3.16	0.9669	Pt-CDC20.3
AT1G03780		AtTPX2, TPX2	targeting protein for XKLP2 (....		Potri.017G013100 [exp]	3.87	0.9690
AT3G17360		POK1	phragmoplast orienting kinesin...		Potri.010G153000 [exp]	7.07	0.9552
AT1G18370		HIK, ATNACK1	HINKEL, ARABIDOPSIS NPK1-ACTIV...		Potri.012G054400 [exp]	7.34	0.9657
AT3G23670		PAKRP1L ,KINESI...	phragmoplast-associated kinesi...		Potri.002G235500 [exp]	7.74	0.9540	PAKRP1.2
AT2G20590			Reticulon family protein (.1.2...		Potri.007G137700 [exp]	8.48	0.9683
AT1G72250			Di-glucose binding protein wit...		Potri.001G436200 [exp]	11.66	0.9568
AT3G06840			unknown protein		Potri.010G010600 [exp]	13.85	0.9383

Compare expression of checked genes

Potri.013G048900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.