Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39110 285 / 3e-98 RmlC-like cupins superfamily protein (.1) AT5G39150 282 / 3e-97 RmlC-like cupins superfamily protein (.1) AT5G39180 281 / 6e-97 RmlC-like cupins superfamily protein (.1) AT5G39120 281 / 7e-97 RmlC-like cupins superfamily protein (.1) AT3G05950 273 / 1e-93 RmlC-like cupins superfamily protein (.1) AT5G39130 272 / 3e-93 RmlC-like cupins superfamily protein (.1) AT5G39190 272 / 4e-93 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39160 271 / 5e-93 RmlC-like cupins superfamily protein (.1.2.3) AT5G38930 270 / 4e-92 RmlC-like cupins superfamily protein (.1) AT5G38940 268 / 2e-91 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G052000 [exp] 409 / 2e-147 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G052300 [exp] 405 / 1e-145 AT5G39110 281 / 2e-96 RmlC-like cupins superfamily protein (.1) Potri.013G064100 [exp] 321 / 2e-112 AT5G39130 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G063050 [exp] 320 / 5e-112 AT5G39130 281 / 1e-96 RmlC-like cupins superfamily protein (.1) Potri.013G062950 [exp] 319 / 1e-111 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G063100 [exp] 319 / 1e-111 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G063001 [exp] 319 / 1e-111 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G063051 [exp] 319 / 1e-111 AT5G39130 284 / 5e-98 RmlC-like cupins superfamily protein (.1) Potri.019G026200 [exp] 310 / 6e-108 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006538 [exp] 303 / 3e-105 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1) Lus10006536 [exp] 302 / 5e-105 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Lus10003116 [exp] 295 / 7e-102 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10000622 [exp] 293 / 3e-101 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1) Lus10003114 [exp] 288 / 3e-99 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006543 [exp] 288 / 3e-99 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10033767 [exp] 287 / 6e-99 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 267 / 3e-91 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10034254 [exp] 266 / 7e-91 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10035278 [exp] 266 / 8e-91 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.013G052100.1 pacid=42811229 polypeptide=Potri.013G052100.1.p locus=Potri.013G052100 ID=Potri.013G052100.1.v4.1 annot-version=v4.1 ATGAAAAGAGTTCATTTTCTTGCAACTTTTGTCTTTCTCGCTTTCGCTGCCTCATTTGCCTTTGCCTCCGACCCTAGTCCTCTACAGGATTTTTGTGTAG CCATCAATGATACTAAGGATGGTGTGTTCGTAAATGGGAAATTCTGCAAGGACCCAAAGCTTGCCACAGAAAATGATTTCTTCTTTCCAGGGCTCAACAT TGCCAGAAACACCTCCAATCCAGTTGGATCGGTGGTCACTCCTGCTAATGTTGCTCAAATTCCAGGGCTCAATACTCTTGGAATATCGCTGGTTCGCATT GATTATGCACCATACGGTGGCCTAAACCCACCACACACTCACCCTCGTGCCACGGAGATCCTAACAGTCCTGGAGGGAACTCTGTATGTTGGCTTTGTCA CATCGAACCCTGATAATCGTCTCATCACCAAAGTCCTAAACCCAGGAGATGTTTTCGTGTTCCCAGTTGGACTCATTCACTTCCAATTCAATGTGGGGAA AACCAAAGCTTCGGCCATTGGTGCCTTGAGCAGCCAGAACCCTGGTGTAATTACAATCGCAAATGCAGTCTTCGGATCCACTCCACCAATTAGATCTGAT GTTCTCGCCAAGGCCTTCCAAGTGGACAAGAATATAGTGGACTATCTTCAGAAGCAGTTCTGGTACGACAACAATTAG
AA sequence Show only first row Show all	>Potri.013G052100.1 pacid=42811229 polypeptide=Potri.013G052100.1.p locus=Potri.013G052100 ID=Potri.013G052100.1.v4.1 annot-version=v4.1 MKRVHFLATFVFLAFAASFAFASDPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPANVAQIPGLNTLGISLVRI DYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNPDNRLITKVLNPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRSD VLAKAFQVDKNIVDYLQKQFWYDNN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G39110			RmlC-like cupins superfamily p...		Potri.013G052100 [exp]	0	1
AT5G39110			RmlC-like cupins superfamily p...		Potri.013G051901 [exp]	1.41	0.9963
AT5G39110			RmlC-like cupins superfamily p...		Potri.013G052000 [exp]	2.00	0.9961
AT2G18210			unknown protein		Potri.007G022200 [exp]	2.82	0.9754
AT5G39110			RmlC-like cupins superfamily p...		Potri.013G052300 [exp]	3.00	0.9855
AT2G35730			Heavy metal transport/detoxifi...		Potri.003G110500 [exp]	6.32	0.9600
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G021100 [exp]	6.92	0.9686
AT2G43390			unknown protein		Potri.007G130200 [exp]	7.07	0.9696
AT2G39430			Disease resistance-responsive ...		Potri.008G049100 [exp]	7.93	0.9665
AT2G27370		CASP3	Casparian strip membrane domai...		Potri.009G160000 [exp]	8.00	0.9638
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.007G122100 [exp]	10.19	0.9533	SEPA1.1

Compare expression of checked genes

Potri.013G052100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.