Potri.013G052600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18310 97 / 8e-26 unknown protein
AT5G48500 54 / 1e-09 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G029600 261 / 2e-90 AT5G18310 94 / 2e-24 unknown protein
Potri.015G040500 152 / 7e-49 AT5G18310 59 / 2e-12 unknown protein
Potri.002G250800 90 / 3e-23 AT5G48500 100 / 2e-27 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042520 137 / 1e-41 AT5G18310 81 / 1e-19 unknown protein
Lus10021984 136 / 4e-41 AT5G18310 76 / 2e-17 unknown protein
Lus10009584 73 / 1e-16 AT5G48500 126 / 3e-37 unknown protein
Lus10020403 70 / 2e-15 AT5G48500 127 / 7e-38 unknown protein
Lus10006540 61 / 4e-12 ND 37 / 0.002
PFAM info
Representative CDS sequence
>Potri.013G052600.1 pacid=42812019 polypeptide=Potri.013G052600.1.p locus=Potri.013G052600 ID=Potri.013G052600.1.v4.1 annot-version=v4.1
ATGGATGAATGGAGAAGAAGTGGACAAATACCAGCATTCGGAAACTGGGACCAGGCAAATGACCTTCCAATCACACTGTATTTTGAGTCTGCAAGACAGG
CAGGATTGATTCGACACAGTACTAATTCCTCTGGAGAATGCGGTCATCGGTACATGCGTAGTGATCTACATGCTTCTGATTTCAACAAGCCTTCTCGTTA
TCATGTTCCTCCCAGAAAGACAAGAATGAGAGAACAGCGAGGCCCGCATTCAAAAGAGCAGAGAAAGCAGGGCAAAGTCTGTGACGTGACTGAACCGGCA
AGGAAACAACAACCCACAATGCTACATTGTCATAAAATAGACGCTGTAATTTGTCCTAAAGTTCCTCTTAAGCCTCCAAAAGCTGTTGATGAAGATCTCT
ACAAAATCCCACCAGAGCTCCTCCGCTCTGCCAAGCGGAAGAAATGCCCCGGATTGTTTTCATGCCTTGTGCCTGCTTGTGCTTCATAG
AA sequence
>Potri.013G052600.1 pacid=42812019 polypeptide=Potri.013G052600.1.p locus=Potri.013G052600 ID=Potri.013G052600.1.v4.1 annot-version=v4.1
MDEWRRSGQIPAFGNWDQANDLPITLYFESARQAGLIRHSTNSSGECGHRYMRSDLHASDFNKPSRYHVPPRKTRMREQRGPHSKEQRKQGKVCDVTEPA
RKQQPTMLHCHKIDAVICPKVPLKPPKAVDEDLYKIPPELLRSAKRKKCPGLFSCLVPACAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18310 unknown protein Potri.013G052600 0 1
AT4G13440 Calcium-binding EF-hand family... Potri.019G026740 8.66 0.8396
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G117300 12.96 0.8209
AT3G61930 unknown protein Potri.002G179000 17.14 0.8175
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.015G120000 18.00 0.8167
AT4G31980 unknown protein Potri.003G208700 29.81 0.8091
AT4G31980 unknown protein Potri.003G208750 30.33 0.8077
AT3G18670 Ankyrin repeat family protein ... Potri.015G119800 33.04 0.8012
AT4G13440 Calcium-binding EF-hand family... Potri.019G026780 34.05 0.8035
AT1G47670 Transmembrane amino acid trans... Potri.002G012900 38.83 0.8011 PTRLHT10
AT5G11290 Plant protein of unknown funct... Potri.003G208400 39.34 0.8044

Potri.013G052600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.