Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04070 338 / 9e-115 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT3G15510 253 / 2e-81 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G69490 248 / 6e-81 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G61110 248 / 5e-80 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G52880 233 / 3e-74 NAC ATNAM, NAM, ANAC018, NARS2 NAC-REGULATED SEED MORPHOLOGY 2, Arabidopsis NAC domain containing protein 18, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G27410 230 / 1e-73 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G01720 228 / 1e-72 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 223 / 3e-71 NAC ANAC032 NAC domain containing protein 32 (.1) AT1G52890 223 / 1e-70 NAC ANAC019 NAC domain containing protein 19 (.1) AT3G15500 223 / 2e-70 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G031400 [exp] 530 / 0 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2) Potri.001G404400 [exp] 268 / 2e-87 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G046700 [exp] 265 / 3e-86 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.011G123500 [exp] 265 / 4e-86 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.004G038000 [exp] 263 / 2e-85 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.008G089000 [exp] 244 / 5e-79 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.004G049500 [exp] 239 / 3e-76 AT1G61110 232 / 4e-74 NAC domain containing protein 25 (.1) Potri.006G129400 [exp] 236 / 4e-75 AT1G61110 247 / 3e-80 NAC domain containing protein 25 (.1) Potri.011G058600 [exp] 233 / 5e-74 AT3G15510 227 / 6e-72 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042531 [exp] 325 / 2e-109 AT3G04070 303 / 4e-101 NAC domain containing protein 47 (.1.2) Lus10021992 [exp] 323 / 2e-108 AT3G04070 295 / 1e-97 NAC domain containing protein 47 (.1.2) Lus10003269 [exp] 321 / 5e-108 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2) Lus10006547 [exp] 319 / 4e-107 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2) Lus10018469 [exp] 271 / 1e-88 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10011215 [exp] 270 / 3e-88 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10032657 [exp] 267 / 1e-86 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 266 / 1e-86 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10030446 [exp] 243 / 6e-79 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10037156 [exp] 244 / 1e-78 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.013G054000.1 pacid=42812399 polypeptide=Potri.013G054000.1.p locus=Potri.013G054000 ID=Potri.013G054000.1.v4.1 annot-version=v4.1 ATGAAGAACCCACAATCAAGCTTGCCCCCAGGGTTTAGGTTCCACCCGACAGATGAGGAGCTCATCCTCCATTACCTTAAGAAGAAGTTGGCATCCACAC CGTTTCCTGTGTCTATCATAGCAGATGTTGACATCTATAAGTTTGATCCGTGGGACTTGCCAGCTAAAGCTTCCTTGGGGGAGAAAGAGTGGTACTTTTT CAGTCCTAGAGATCGCAAGTACCCCAATGGAGCAAGGCCTAACAGAGCAGCTGCATCTGGATATTGGAAGGCAACTGGGACAGACAAAATCATAATGGCA TCAACAATGGCACCAGGAGGTGTAGTTGGAGGGCAAGAGAACATTGGAGTTAAAAAGGCTCTTGTTTTCTACAAGGGAAAGCCTCCAAAGGGTGTCAAGA CTAATTGGATCATGCATGAGTATCGCCTAGCAGATAACCCCGCCTGCAACAACAACAAGAAATCCATGAAGCCAAAAGATTCATCCATGAGGTTAGATGA TTGGGTTCTTTGCCGGATTTACAAGAAATCCCATGCCTTGACTTCATCTCCAAGGGCATTAATATCCAGTGAACATGACCAAGAAGAAGAAGAAGAACAA CAACAACAACAACAATTTGTCCAAGAAACCCTTTTACCCATAAGCAACAAGAATAATCTCATGTCCCAGAAATCTTGTTCTTTCTCCAACTTGTTCGATG CCATGGACTACTCCATGTGGAGTAGTTTCCTGGCAGATACCCCATTCAATCCAACAGGGTTTGAGTCAAATCCTACATTGAATAGTACTGCAACACAGTT GGACCAACCTTTCTTCAGTAACAGCAACTCTGCAAGCAACAGTAACAGCACGAGCAGCGGTTCCTTTCTTCAGAAGTTACCTCAGTTGAACACTTCAATG CCAAACATGCAGGAGAATAAACTCAAGCGCCAGCTTCCACACATTGACGAGGACTTGCTGCACCCATCAAAAAAGTTCATGAACTCTTGCAGTTTCACTA ACACCAACAATAATACTCAAACTGATATGGGTCAATACAATTTCGTAAGCCAGCCATTCTTGGACCAGCAATTGCTTTTGAGCCCACATCTTCAATTTCT AGGTTAA
AA sequence Show only first row Show all	>Potri.013G054000.1 pacid=42812399 polypeptide=Potri.013G054000.1.p locus=Potri.013G054000 ID=Potri.013G054000.1.v4.1 annot-version=v4.1 MKNPQSSLPPGFRFHPTDEELILHYLKKKLASTPFPVSIIADVDIYKFDPWDLPAKASLGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKIIMA STMAPGGVVGGQENIGVKKALVFYKGKPPKGVKTNWIMHEYRLADNPACNNNKKSMKPKDSSMRLDDWVLCRIYKKSHALTSSPRALISSEHDQEEEEEQ QQQQQFVQETLLPISNKNNLMSQKSCSFSNLFDAMDYSMWSSFLADTPFNPTGFESNPTLNSTATQLDQPFFSNSNSASNSNSTSSGSFLQKLPQLNTSM PNMQENKLKRQLPHIDEDLLHPSKKFMNSCSFTNTNNNTQTDMGQYNFVSQPFLDQQLLLSPHLQFLG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.013G054000 [exp]	0	1
AT5G52430			hydroxyproline-rich glycoprote...		Potri.003G129400 [exp]	2.00	0.9524
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Potri.002G121200 [exp]	4.24	0.9520	Pt-IFS1.43
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Potri.007G075000 [exp]	7.48	0.9318
AT1G06050			Protein of unknown function (D...		Potri.007G130400 [exp]	8.77	0.9381
					Potri.001G131600 [exp]	10.95	0.9450
AT5G61430	NAC	ANAC100, ATNAC5	NAC domain containing protein ...		Potri.017G086200 [exp]	11.74	0.9250	NAC028
AT5G66580			unknown protein		Potri.018G143700 [exp]	12.72	0.9308
AT5G49900			Beta-glucosidase, GBA2 type fa...		Potri.003G003400 [exp]	13.03	0.9372
AT3G50770		CML41	calmodulin-like 41 (.1)		Potri.005G128100 [exp]	14.83	0.9346
AT1G19260			TTF-type zinc finger protein w...		Potri.014G176150 [exp]	17.29	0.9335

Compare expression of checked genes

Potri.013G054000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.