Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR9
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31320 58 / 1e-11 SAUR-like auxin-responsive protein family (.1) AT4G38850 54 / 8e-11 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT2G24400 54 / 3e-10 SAUR-like auxin-responsive protein family (.1) AT4G13790 50 / 2e-09 SAUR-like auxin-responsive protein family (.1) AT4G38825 50 / 2e-09 SAUR-like auxin-responsive protein family (.1) AT4G38840 50 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT4G38820 49 / 5e-09 unknown protein AT4G34770 49 / 8e-09 SAUR-like auxin-responsive protein family (.1) AT2G21210 48 / 2e-08 SAUR-like auxin-responsive protein family (.1) AT3G03840 47 / 3e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G278100 [exp] 58 / 8e-12 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.010G253800 [exp] 52 / 2e-09 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.008G003900 [exp] 51 / 3e-09 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1) Potri.006G070600 [exp] 51 / 4e-09 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 49 / 5e-09 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.018G132400 [exp] 50 / 1e-08 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 48 / 1e-08 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165800 [exp] 48 / 2e-08 AT4G34770 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 48 / 2e-08 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039962 [exp] 72 / 8e-18 AT5G18080 50 / 1e-09 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Lus10027690 [exp] 67 / 1e-15 AT5G18020 52 / 2e-10 SAUR-like auxin-responsive protein family (.1) Lus10033348 [exp] 61 / 1e-12 AT2G24400 155 / 3e-48 SAUR-like auxin-responsive protein family (.1) Lus10026977 [exp] 60 / 4e-12 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 53 / 8e-10 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 53 / 9e-10 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10035716 [exp] 52 / 5e-09 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 49 / 9e-09 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 49 / 1e-08 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10031178 [exp] 49 / 2e-08 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.013G054600.1 pacid=42811740 polypeptide=Potri.013G054600.1.p locus=Potri.013G054600 ID=Potri.013G054600.1.v4.1 annot-version=v4.1 ATGTATTCATCAAGAAACATGCAAGAAAGATTAGGTTCTCTTGTCAACAAGTTCTTCGAGAAGGATTTCAAAGGCTCCCTTGCAGTGATTGGGAGTGCGA AGACGCGAAGAGGGTATGTAGCTATGTATGTGGGGGAAGAAGGTAAACGATACGAAGTTCCAGTGAAATACCTATCCAATCCAGTATTCCAAGAACTGCT TAGGCGATCGCAGCATCAAGATCTTGACTACAAGATTGAAGGGGCAATTCGGATTCCTCACTCAACTGCTTTTTTTGATCAATTCTTAAGGATTATCAAG GAGTACTTCTAG
AA sequence Show only first row Show all	>Potri.013G054600.1 pacid=42811740 polypeptide=Potri.013G054600.1.p locus=Potri.013G054600 ID=Potri.013G054600.1.v4.1 annot-version=v4.1 MYSSRNMQERLGSLVNKFFEKDFKGSLAVIGSAKTRRGYVAMYVGEEGKRYEVPVKYLSNPVFQELLRRSQHQDLDYKIEGAIRIPHSTAFFDQFLRIIK EYF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G31320			SAUR-like auxin-responsive pro...		Potri.013G054600 [exp]	0	1	SAUR9
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Potri.009G123600 [exp]	6.85	0.7468	/F5H2,Pt-IFS1.57
AT1G60500		DRP4C	Dynamin related protein 4C (.1...		Potri.001G095900 [exp]	12.40	0.6557
					Potri.001G377032 [exp]	41.71	0.6000
AT1G08790			Protein of unknown function (D...		Potri.013G042400 [exp]	64.10	0.5956
AT5G57500			Galactosyltransferase family p...		Potri.007G131000 [exp]	65.09	0.6526
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Potri.001G397900 [exp]	66.09	0.5879
AT3G59510			Leucine-rich repeat (LRR) fami...		Potri.017G028600 [exp]	69.94	0.6503
AT5G12890			UDP-Glycosyltransferase superf...		Potri.001G016500 [exp]	145.48	0.6125
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.004G194600 [exp]	179.00	0.5852	GER2.24

Compare expression of checked genes

Potri.013G054600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.