Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54400 93 / 4e-24 HSP20-like chaperones superfamily protein (.1) AT2G27140 72 / 1e-15 HSP20-like chaperones superfamily protein (.1) AT5G04890 71 / 1e-14 RTM2 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) AT5G20970 59 / 5e-11 HSP20-like chaperones superfamily protein (.1) AT1G07400 55 / 6e-10 HSP20-like chaperones superfamily protein (.1) AT1G59860 53 / 3e-09 HSP20-like chaperones superfamily protein (.1) AT5G37670 51 / 2e-08 HSP15.7CI HSP20-like chaperones superfamily protein (.1) AT1G53540 49 / 9e-08 HSP20-like chaperones superfamily protein (.1) AT4G10250 46 / 2e-06 ATHSP22.0 HSP20-like chaperones superfamily protein (.1) AT4G27670 41 / 0.0002 HSP21 heat shock protein 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G054800 [exp] 265 / 3e-92 AT1G54400 98 / 6e-26 HSP20-like chaperones superfamily protein (.1) Potri.019G037700 [exp] 163 / 7e-52 AT1G54400 93 / 5e-24 HSP20-like chaperones superfamily protein (.1) Potri.013G054900 [exp] 101 / 3e-27 AT1G54400 97 / 3e-25 HSP20-like chaperones superfamily protein (.1) Potri.008G013800 [exp] 68 / 7e-14 AT5G04890 135 / 3e-36 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Potri.010G245500 [exp] 66 / 3e-13 AT5G04890 113 / 2e-28 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Potri.012G070100 [exp] 65 / 3e-13 AT2G27140 74 / 3e-16 HSP20-like chaperones superfamily protein (.1) Potri.004G191101 [exp] 65 / 1e-12 AT2G27140 109 / 2e-28 HSP20-like chaperones superfamily protein (.1) Potri.004G191200 [exp] 64 / 2e-12 AT2G27140 106 / 3e-27 HSP20-like chaperones superfamily protein (.1) Potri.015G064800 [exp] 61 / 1e-11 AT1G07400 64 / 7e-13 HSP20-like chaperones superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032902 [exp] 89 / 2e-22 AT1G54400 89 / 4e-22 HSP20-like chaperones superfamily protein (.1) Lus10028874 [exp] 67 / 3e-13 AT5G04890 103 / 4e-24 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Lus10008426 [exp] 66 / 6e-13 AT2G27140 111 / 7e-29 HSP20-like chaperones superfamily protein (.1) Lus10013655 [exp] 62 / 2e-12 AT1G54400 72 / 3e-16 HSP20-like chaperones superfamily protein (.1) Lus10008946 [exp] 63 / 4e-12 AT5G04890 102 / 3e-24 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Lus10003356 [exp] 54 / 9e-09 AT2G27140 103 / 3e-26 HSP20-like chaperones superfamily protein (.1) Lus10004039 [exp] 49 / 4e-08 AT5G37670 150 / 3e-48 HSP20-like chaperones superfamily protein (.1) Lus10042408 [exp] 49 / 1e-07 AT4G10250 154 / 1e-47 HSP20-like chaperones superfamily protein (.1) Lus10026262 [exp] 47 / 1e-06 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1) Lus10028577 [exp] 44 / 3e-05 AT1G76770 152 / 3e-44 HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [poplar] [flax] HSP20 PF00011 [poplar] [flax] HSP20 Hsp20/alpha crystallin family
Representative CDS sequence Show only first row Show all	>Potri.013G054700.2 pacid=42810999 polypeptide=Potri.013G054700.2.p locus=Potri.013G054700 ID=Potri.013G054700.2.v4.1 annot-version=v4.1 ATGGAAACCTTCAAGCTGTATTATGATGATTTTGAGCCCTTTTGCCAGTGGAAAGAGGATGAACATGCGATACTTGAGATCCATCTACGAGGATTCAAAA AACAACACCTGAGGGTCCAAATAGAGGAACCTGGTGTTGTGAAAATTACTGGAGAGCGACCTATAGATGGTACTCTACGTTGCCGCTTTCGTAAGCAAAT CAAGATCCCAAAGAATTGTAAAACAGATGAAATTCGGGCTAAGTTATCTGGTGATATTCTTCAAATAATACTGCCTAAGCAAACAACTGCATTTCCTCGA AAACCAGGCAGCACTGAATGTATTACAAGAAGTGAAAGTATGCCATCAAATTACTTGTTATACATAGAGAGTTCAAGTTGGACACTAGAGATGACTACCA AGTTAGCTCTACAAGTTGCAGGAGTGCTTGCTGTGGTAGTGGCTTTTGGAGCTTCTGCTTACAAGTACTGTCATTGTGGTCATGTTGAAGGCTAA
AA sequence Show only first row Show all	>Potri.013G054700.2 pacid=42810999 polypeptide=Potri.013G054700.2.p locus=Potri.013G054700 ID=Potri.013G054700.2.v4.1 annot-version=v4.1 METFKLYYDDFEPFCQWKEDEHAILEIHLRGFKKQHLRVQIEEPGVVKITGERPIDGTLRCRFRKQIKIPKNCKTDEIRAKLSGDILQIILPKQTTAFPR KPGSTECITRSESMPSNYLLYIESSSWTLEMTTKLALQVAGVLAVVVAFGASAYKYCHCGHVEG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54400			HSP20-like chaperones superfam...		Potri.013G054700 [exp]	0	1
AT3G50120			Plant protein of unknown funct...		Potri.001G071400 [exp]	2.23	0.9853
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Potri.015G030200 [exp]	3.16	0.9844	NAC017
AT1G14730			Cytochrome b561/ferric reducta...		Potri.010G102400 [exp]	4.89	0.9824
AT1G54860			Glycoprotein membrane precurso...		Potri.005G034300 [exp]	5.19	0.9834
AT1G77700			Pathogenesis-related thaumatin...		Potri.002G087100 [exp]	5.65	0.9792
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Potri.012G038100 [exp]	5.91	0.9820	NAC020
AT2G34540			unknown protein		Potri.004G064900 [exp]	6.24	0.9730
AT3G15680			Ran BP2/NZF zinc finger-like s...		Potri.001G172700 [exp]	6.40	0.9505
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.010G050200 [exp]	6.92	0.9715
AT3G17380			TRAF-like family protein (.1)		Potri.008G005300 [exp]	8.12	0.9809

Compare expression of checked genes

Potri.013G054700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.