Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G32450 389 / 7e-138 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT5G46870 200 / 3e-63 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G16840 196 / 4e-62 BPA1 binding partner of acd11 1 (.1.2.3) AT4G17720 197 / 1e-61 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G67950 174 / 4e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) AT1G14340 153 / 2e-45 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G01210 129 / 5e-36 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G16940 47 / 9e-06 Splicing factor, CC1-like (.1.2.3) AT5G09880 44 / 8e-05 Splicing factor, CC1-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G037600 [exp] 502 / 0 AT5G32450 400 / 2e-142 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G138400 [exp] 213 / 3e-68 AT4G17720 365 / 2e-127 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.003G095400 [exp] 199 / 8e-63 AT4G17720 355 / 9e-124 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G103600 [exp] 193 / 3e-60 AT1G67950 280 / 6e-94 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) Potri.017G081500 [exp] 147 / 2e-43 AT1G14340 239 / 6e-80 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.017G081400 [exp] 145 / 2e-42 AT1G14340 229 / 3e-75 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G070200 [exp] 64 / 4e-12 AT5G32450 65 / 8e-13 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.007G009800 [exp] 48 / 4e-06 AT5G09880 519 / 9e-180 Splicing factor, CC1-like (.1) Potri.004G177000 [exp] 47 / 7e-06 AT2G16940 538 / 0.0 Splicing factor, CC1-like (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013651 [exp] 373 / 1e-128 AT5G32450 343 / 5e-117 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10010660 [exp] 364 / 4e-127 AT5G32450 352 / 3e-122 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10040095 [exp] 199 / 1e-62 AT4G17720 379 / 8e-133 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10030952 [exp] 195 / 4e-61 AT4G17720 382 / 7e-134 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10011063 [exp] 188 / 4e-58 AT4G17720 333 / 2e-114 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10025743 [exp] 182 / 2e-56 AT4G17720 295 / 4e-100 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10000676 [exp] 178 / 3e-54 AT4G17720 313 / 1e-106 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10030491 [exp] 156 / 1e-46 AT1G14340 300 / 1e-103 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10012843 [exp] 152 / 5e-45 AT1G14340 301 / 5e-104 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10035919 [exp] 139 / 1e-39 AT4G17720 226 / 3e-73 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.013G055100.2 pacid=42810919 polypeptide=Potri.013G055100.2.p locus=Potri.013G055100 ID=Potri.013G055100.2.v4.1 annot-version=v4.1 ATGCAGACAAGAACAGTAGAAGTGAAGAATGTATCAGATCTTGCTAGTGAGAGAGAAGTTCACGAGTTCTTCTCCTTCTCTGGCGAAATCGAAAACATTC ACATCCAACGTGACCATGGGCAATCAAAGACTGCATTTGTTACCTTCAAAGATCCTAAAGCACTTGAAATTGCCTTGTTGTTATCGGGAGCAACTATAGT TGACCAGATAGTGGCTATAACTCCTGTGGAAAATTATGTACCAAATCGTGAGCTACAGGAAGTAAGGAATATGGACATCGCAATACATGTAGTTCCTTCT GAAGACTTCCCATCAAATGTTGAGCAGGGGAAAACTAGCCCTTCAGGCAGCGGAAGAGTCTATGTCAGTAGAGCACAAGAAGTTGTCACAAGTATGCTAG CAAAAGGTTCAGCTATTGGCCAAGATGCAATGAATAAGGCCAAGGCATTTGATGAGAAACATCGTTTGAGTGCCAATGCATCTGAGAAGGTAATTTCATT TGATCGAAGAGTTGGGCTAACAGAGAAATTGACTGTTGGAATTTCGGTAGTTAACGAGAAAGTGAAGTCTGTTGACCAAAGGCTTCATGTATCGGATAAA ACAATGGCAGCGATATTTGCAGCTGAAAGGAAGATAAATGACACAGGATCAGCTGTAAAATCAAGCAGGTATGTGAGTGCTGGGACAGCATGGCTAAATG GTGCCTTTAGTAAGGTGGCGAAGGCTGGGCAGGTTGCTGGTACAAAAACAAGAGCAAAGTTCAATTCGGCTGTTTCGAATTTGACTGCTAAGGAATCTCC GATCGCTGTATGA
AA sequence Show only first row Show all	>Potri.013G055100.2 pacid=42810919 polypeptide=Potri.013G055100.2.p locus=Potri.013G055100 ID=Potri.013G055100.2.v4.1 annot-version=v4.1 MQTRTVEVKNVSDLASEREVHEFFSFSGEIENIHIQRDHGQSKTAFVTFKDPKALEIALLLSGATIVDQIVAITPVENYVPNRELQEVRNMDIAIHVVPS EDFPSNVEQGKTSPSGSGRVYVSRAQEVVTSMLAKGSAIGQDAMNKAKAFDEKHRLSANASEKVISFDRRVGLTEKLTVGISVVNEKVKSVDQRLHVSDK TMAAIFAAERKINDTGSAVKSSRYVSAGTAWLNGAFSKVAKAGQVAGTKTRAKFNSAVSNLTAKESPIAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G32450			RNA binding (RRM/RBD/RNP motif...		Potri.013G055100 [exp]	0	1
AT5G51150			Mitochondrial import inner mem...		Potri.015G111200 [exp]	3.16	0.8874
AT4G17486			PPPDE putative thiol peptidase...		Potri.006G154400 [exp]	6.16	0.9153
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Potri.009G047300 [exp]	6.70	0.9056
AT3G09800			SNARE-like superfamily protein...		Potri.001G197200 [exp]	6.85	0.9181
AT5G57330			Galactose mutarotase-like supe...		Potri.003G187300 [exp]	9.38	0.8769
AT1G79500		ATKDSA1, KDSA	Aldolase-type TIM barrel famil...		Potri.005G199100 [exp]	12.64	0.9000	Pt-KDSA.2
AT4G27720			Major facilitator superfamily ...		Potri.015G008100 [exp]	17.83	0.8914
AT1G47840		HXK3	hexokinase 3 (.1)		Potri.005G238600 [exp]	20.27	0.8345
AT4G29340		PRF4	profilin 4 (.1)		Potri.006G235200 [exp]	20.39	0.9005	Pt-PRO1.4
AT1G56700			Peptidase C15, pyroglutamyl pe...		Potri.013G005100 [exp]	20.49	0.8792

Compare expression of checked genes

Potri.013G055100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.