Potri.013G058200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18150 114 / 5e-35 Methyltransferase-related protein (.1)
AT5G14602 108 / 2e-32 unknown protein
AT5G58375 69 / 7e-17 Methyltransferase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G035000 162 / 5e-54 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1)
Potri.013G155800 68 / 1e-16 AT5G58375 67 / 5e-16 Methyltransferase-related protein (.1)
Potri.019G127900 57 / 5e-12 AT5G58375 64 / 6e-15 Methyltransferase-related protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020287 121 / 1e-37 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1)
Lus10005698 119 / 8e-37 AT5G18150 108 / 1e-32 Methyltransferase-related protein (.1)
Lus10034423 85 / 6e-23 AT5G18150 87 / 5e-24 Methyltransferase-related protein (.1)
Lus10019138 83 / 2e-22 AT5G18150 80 / 3e-21 Methyltransferase-related protein (.1)
Lus10042227 69 / 1e-16 AT5G58375 91 / 2e-25 Methyltransferase-related protein (.1)
Lus10008585 66 / 1e-15 AT5G58375 89 / 1e-24 Methyltransferase-related protein (.1)
PFAM info
Representative CDS sequence
>Potri.013G058200.1 pacid=42810755 polypeptide=Potri.013G058200.1.p locus=Potri.013G058200 ID=Potri.013G058200.1.v4.1 annot-version=v4.1
ATGTGTCCTTTAAGGTTTATCTTGGTGTTCTTCTCAGCCGTTTTAGCTGGATATTTTGCATGGAGGACAGTACGATCATCGCCCGAGATTGATGATTTTG
TTTCCGATGATTCAACTGCTGAAAAGACTTCCTTGAGAGAGAAACAAGAATTCAATTTCAAAAGGATTATTCAAAATGGATTCTGGGTATTTGTCGATAT
GGCTAGTGGGAGGTACTTGTGGAGGAATTTTAAGGAGATGAAGAAAGATGAGACATTGAAAAGCTTATAG
AA sequence
>Potri.013G058200.1 pacid=42810755 polypeptide=Potri.013G058200.1.p locus=Potri.013G058200 ID=Potri.013G058200.1.v4.1 annot-version=v4.1
MCPLRFILVFFSAVLAGYFAWRTVRSSPEIDDFVSDDSTAEKTSLREKQEFNFKRIIQNGFWVFVDMASGRYLWRNFKEMKKDETLKSL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18150 Methyltransferase-related prot... Potri.013G058200 0 1
AT4G01250 WRKY ATWRKY22, WRKY2... WRKY family transcription fact... Potri.002G164400 5.29 0.7334
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Potri.005G219000 7.14 0.6589
AT5G48655 RING/U-box superfamily protein... Potri.002G245500 12.36 0.7033
AT4G01250 WRKY ATWRKY22, WRKY2... WRKY family transcription fact... Potri.014G090300 12.68 0.7063 Pt-WRKY22.2
AT3G14770 SWEET2, AtSWEET... Nodulin MtN3 family protein (.... Potri.011G103600 17.66 0.7106
AT3G47570 Leucine-rich repeat protein ki... Potri.006G099100 18.76 0.7168
AT3G03280 unknown protein Potri.010G116000 20.78 0.7060
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.001G330501 23.23 0.6982
AT1G80450 VQ motif-containing protein (.... Potri.006G266700 24.49 0.6741
AT4G31550 WRKY ATWRKY11, WRKY1... WRKY DNA-binding protein 11 (.... Potri.018G139300 25.51 0.6356

Potri.013G058200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.