Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64770 79 / 3e-19 PnsB2, NDH45, NDF2 Photosynthetic NDH subcomplex B 2, NAD\(P\)H DEHYDROGENASE SUBUNIT 45, NDH-dependent cyclic electron flow 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G034100 [exp] 122 / 1e-35 AT1G64770 417 / 3e-146 Photosynthetic NDH subcomplex B 2, NAD\(P\)H DEHYDROGENASE SUBUNIT 45, NDH-dependent cyclic electron flow 1 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010671 [exp] 117 / 2e-33 AT1G64770 413 / 1e-144 Photosynthetic NDH subcomplex B 2, NAD\(P\)H DEHYDROGENASE SUBUNIT 45, NDH-dependent cyclic electron flow 1 (.1.2.3) Lus10007429 [exp] 116 / 4e-33 AT1G64770 408 / 2e-142 Photosynthetic NDH subcomplex B 2, NAD\(P\)H DEHYDROGENASE SUBUNIT 45, NDH-dependent cyclic electron flow 1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G058601.1 pacid=42810795 polypeptide=Potri.013G058601.1.p locus=Potri.013G058601 ID=Potri.013G058601.1.v4.1 annot-version=v4.1 ATGAAAGTAGAGTCTCCGAGAATGTTTGATTTTGATTTCGAGCCTGAAGAGAAACCTGGGTTATGGAAAGTGCAAGATGAGCCCTTCACAATTTTGAAGA ATAGGCTTGGTAGAGTTTATGCTGCTCCACCAGAAGAGAGGTTGAAAGCATTCTATAACACCTCTCCTACAAAATATGAAGCGCTCGATCAGGGAAAAGA GCTTATCTTCAGGTGA
AA sequence Show only first row Show all	>Potri.013G058601.1 pacid=42810795 polypeptide=Potri.013G058601.1.p locus=Potri.013G058601 ID=Potri.013G058601.1.v4.1 annot-version=v4.1 MKVESPRMFDFDFEPEEKPGLWKVQDEPFTILKNRLGRVYAAPPEERLKAFYNTSPTKYEALDQGKELIFR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64770		PnsB2, NDH45, N...	Photosynthetic NDH subcomplex...		Potri.013G058601 [exp]	0	1
AT1G30950		UFO	UNUSUAL FLORAL ORGANS, F-box f...		Potri.003G074100 [exp]	5.47	0.6931	Pt-UFO.1
AT4G32150		ATVAMP711, VAMP...	vesicle-associated membrane pr...		Potri.018G125900 [exp]	9.38	0.6921
AT1G04645			Plant self-incompatibility pro...		Potri.018G148630 [exp]	13.26	0.6921
AT1G68510	AS2	LBD42	LOB domain-containing protein ...		Potri.008G120600 [exp]	17.14	0.6740
AT2G17950	HD	WUS1, PGA6, WUS	WUSCHEL 1, WUSCHEL, Homeodomai...		Potri.007G012100 [exp]	24.14	0.6163
AT4G20820			FAD-binding Berberine family p...		Potri.001G461700 [exp]	26.98	0.6023
AT5G42567			Protein of unknown function (D...		Potri.018G045250 [exp]	28.77	0.5901
AT4G38040			Exostosin family protein (.1)		Potri.012G091600 [exp]	29.74	0.6003
AT1G69630			F-box/RNI-like superfamily pro...		Potri.013G146800 [exp]	30.72	0.5981
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Potri.010G044500 [exp]	41.43	0.5959

Compare expression of checked genes

Potri.013G058601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.