Potri.013G063101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39130 237 / 3e-80 RmlC-like cupins superfamily protein (.1)
AT5G39190 234 / 2e-79 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
AT5G39160 234 / 5e-79 RmlC-like cupins superfamily protein (.1.2.3)
AT5G39110 230 / 1e-77 RmlC-like cupins superfamily protein (.1)
AT3G05950 228 / 1e-76 RmlC-like cupins superfamily protein (.1)
AT5G39150 228 / 1e-76 RmlC-like cupins superfamily protein (.1)
AT5G39120 227 / 2e-76 RmlC-like cupins superfamily protein (.1)
AT5G39180 227 / 2e-76 RmlC-like cupins superfamily protein (.1)
AT5G38930 215 / 1e-71 RmlC-like cupins superfamily protein (.1)
AT5G38940 214 / 2e-71 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G063001 315 / 3e-111 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G063100 315 / 3e-111 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G062950 315 / 3e-111 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G063051 314 / 9e-111 AT5G39130 284 / 5e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G064100 313 / 4e-110 AT5G39130 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Potri.013G063050 311 / 1e-109 AT5G39130 281 / 1e-96 RmlC-like cupins superfamily protein (.1)
Potri.013G051700 269 / 6e-93 AT3G05950 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
Potri.013G051600 267 / 2e-92 AT3G05950 296 / 1e-102 RmlC-like cupins superfamily protein (.1)
Potri.013G063200 267 / 2e-92 AT5G39130 228 / 5e-76 RmlC-like cupins superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000622 248 / 2e-84 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1)
Lus10006538 246 / 7e-84 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1)
Lus10003116 243 / 1e-82 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10003114 243 / 1e-82 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10006543 243 / 1e-82 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10006536 242 / 4e-82 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Lus10033767 239 / 5e-81 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
Lus10003267 209 / 3e-69 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1)
Lus10035185 205 / 7e-68 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10032016 205 / 1e-67 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF07883 Cupin_2 Cupin domain
Representative CDS sequence
>Potri.013G063101.1 pacid=42811041 polypeptide=Potri.013G063101.1.p locus=Potri.013G063101 ID=Potri.013G063101.1.v4.1 annot-version=v4.1
ATGCATGCAGTGTTCGTGAACGGAAAGTTCTGCAAGGACCCGGAGCAAGTTACTGCAAAGGATTTCTTCTTTCCTGGACTCAACGTTCCTCGGGACACTT
CCAGTGCAGTTGGTTCAAATGTCACTGCTGTCAATGTTGCTCAAATTCCAGGACTCAACACTCTTGGCATATCCTTCGCTCGCATTGATTTTGCACCACA
TGGTGGCCTGAACCCACCCCACACTCACCCTCGTGCCACTGAGATCCTAGTAGTCGTGGAGGGTACCCTCTATGTTGGTTTTGTCACATCTAACTTAGCT
AACGGAGATAATCGCCTAATCACCAAGGTCTTAAATCCCGGAGATGTTTTTGTGTTCCCAGTCGGACTCATTCATTTCCAGCTCAATGTGGGAAAAACCA
ATGCCGTTGCATTCGCCAGTTTAAGCAGCCAGAACCCTGGTGTGATTACAATTGCAAAAGCAGTGTTTGGAGCAGATCCACCATTAATCCTAATGTTCTA
A
AA sequence
>Potri.013G063101.1 pacid=42811041 polypeptide=Potri.013G063101.1.p locus=Potri.013G063101 ID=Potri.013G063101.1.v4.1 annot-version=v4.1
MHAVFVNGKFCKDPEQVTAKDFFFPGLNVPRDTSSAVGSNVTAVNVAQIPGLNTLGISFARIDFAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLA
NGDNRLITKVLNPGDVFVFPVGLIHFQLNVGKTNAVAFASLSSQNPGVITIAKAVFGADPPLILMF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G39130 RmlC-like cupins superfamily p... Potri.013G063101 0 1
AT5G39130 RmlC-like cupins superfamily p... Potri.013G063200 3.46 0.9959
AT5G39130 RmlC-like cupins superfamily p... Potri.013G064100 3.46 0.9955
AT5G39130 RmlC-like cupins superfamily p... Potri.013G063051 7.74 0.9933
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.005G221000 8.12 0.9146
AT5G39130 RmlC-like cupins superfamily p... Potri.013G062950 8.48 0.9930
AT1G08440 Aluminium activated malate tra... Potri.001G217300 10.09 0.9269
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.019G078600 10.24 0.9149
AT5G39130 RmlC-like cupins superfamily p... Potri.013G063100 10.81 0.9898
AT4G39230 NmrA-like negative transcripti... Potri.007G036500 10.95 0.9346 PCBER5
AT2G37530 unknown protein Potri.006G083800 11.22 0.9208

Potri.013G063101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.