Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	UBC1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02760 313 / 1e-111 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 310 / 1e-110 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 284 / 4e-100 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT4G27960 147 / 6e-46 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 146 / 1e-45 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G53300 145 / 1e-45 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G41700 143 / 1e-44 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 142 / 3e-44 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT2G16740 142 / 6e-44 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 141 / 1e-43 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G039200 [exp] 315 / 2e-112 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G064000 [exp] 312 / 2e-111 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.003G136200 [exp] 146 / 1e-45 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.015G023300 [exp] 145 / 2e-45 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 145 / 2e-45 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.016G138900 [exp] 145 / 2e-45 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 145 / 2e-45 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.001G094900 [exp] 145 / 2e-45 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 144 / 6e-45 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036727 [exp] 313 / 2e-111 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 313 / 2e-111 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 310 / 2e-110 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 308 / 9e-110 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10014942 [exp] 147 / 7e-46 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 147 / 7e-46 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 146 / 1e-45 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 146 / 1e-45 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 146 / 1e-45 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 146 / 1e-45 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.013G064400.2 pacid=42812489 polypeptide=Potri.013G064400.2.p locus=Potri.013G064400 ID=Potri.013G064400.2.v4.1 annot-version=v4.1 ATGTCAACCCCAGCAAGGAAGAGGTTGATGAGGGATTTCAAGAGGCTTCAGCAGGATCCACCTGCTGGTATCAGTGGAGCCCCTCAAGACAACAACATCA TGCTCTGGAACGCTGTTATTTTTGGACCTGATGATACTCCTTGGGATGGAGGGACGTTTAAGTTGACTCTTCAATTCACAGAGGATTATCCAAATAAACC TCCAACAGTCCGCTTTGTCTCTCGAATGTTTCATCCAAATATTTATGCAGATGGAAGTATATGCTTAGACATTTTACAAAATCAGTGGAGTCCCATATAT GATGTTGCTGCTATACTAACTTCCATCCAGTCCCTGCTCTGTGATCCAAACCCAAATTCCCCAGCAAACTCTGAAGCCGCTCGCATGTTCAGTGAGAATA AGCGGGAATACAATCGCAGAGTTCGTGAAATTGTGGAGCAGAGCTGGACTGCTGACTGA
AA sequence Show only first row Show all	>Potri.013G064400.2 pacid=42812489 polypeptide=Potri.013G064400.2.p locus=Potri.013G064400 ID=Potri.013G064400.2.v4.1 annot-version=v4.1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIY DVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Potri.013G064400 [exp]	0	1	UBC1.1
AT4G10100		CNX7, SIR5	"co-factor for nitrate, reduct...		Potri.019G070801 [exp]	1.41	0.7671
AT2G34450			HMG-box (high mobility group) ...		Potri.004G131400 [exp]	6.00	0.6647
AT1G73030		CHMP1A, VPS46.2	CHARGED MULTIVESICULAR BODY PR...		Potri.003G045300 [exp]	19.36	0.6692
AT1G51200			A20/AN1-like zinc finger famil...		Potri.016G051700 [exp]	22.44	0.6941
AT1G49410		TOM6	translocase of the outer mitoc...		Potri.009G110100 [exp]	23.55	0.7090
AT1G51060		HTA10	histone H2A 10 (.1)		Potri.011G131400 [exp]	24.28	0.6933	HTA901
AT5G61310			Cytochrome c oxidase subunit V...		Potri.014G120500 [exp]	24.39	0.6957
AT4G29480			Mitochondrial ATP synthase sub...		Potri.006G231900 [exp]	25.80	0.6940
AT3G22950		ATARFC1	ADP-ribosylation factor C1 (.1...		Potri.012G139900 [exp]	29.66	0.6601
AT3G11730		ATFP8, AtRABD1	ARABIDOPSIS THALIANA RAB GTPAS...		Potri.004G226600 [exp]	40.98	0.6456

Compare expression of checked genes

Potri.013G064400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.