Potri.013G066620 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.013G066620.1 pacid=42812717 polypeptide=Potri.013G066620.1.p locus=Potri.013G066620 ID=Potri.013G066620.1.v4.1 annot-version=v4.1
ATGCTCATGGTGGATTTTCCCATCAGATGCAACCGTAGCAGGGCTTATGGCAGGGACTCTTGCTGTTGTGTGATTGCAGCACCCGAGAAGCACCCACCAC
GGTCTAACATTTCACCACAAGGACCAATCTTTTGTCACTCATGCGGTCCATTTTCGATCATGATGGAGATGGGAGAGTCATGCTTTGAGTTGAATCTCTA
CTACTCTGCCATCCACTTCCGAAACATCACCAAGCCTGATACCGAACAAGGCATCCATCACCGTCTTCCTGCAGCAAAGGTTCTTTGCTTGACAGCTTTG
AAACGTCGTCCCCGACCCCCTTCCCTCGCGAGGTTTGGCTATGCTCTATAA
AA sequence
>Potri.013G066620.1 pacid=42812717 polypeptide=Potri.013G066620.1.p locus=Potri.013G066620 ID=Potri.013G066620.1.v4.1 annot-version=v4.1
MLMVDFPIRCNRSRAYGRDSCCCVIAAPEKHPPRSNISPQGPIFCHSCGPFSIMMEMGESCFELNLYYSAIHFRNITKPDTEQGIHHRLPAAKVLCLTAL
KRRPRPPSLARFGYAL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G066620 0 1
Potri.012G007445 5.65 0.9807
AT5G20940 Glycosyl hydrolase family prot... Potri.009G154032 11.66 0.9763
AT5G11390 WIT1 WPP domain-interacting protein... Potri.004G111350 16.24 0.9751
Potri.018G055900 17.60 0.9324
Potri.014G163733 18.16 0.9746
AT3G55870 ADC synthase superfamily prote... Potri.008G066600 19.41 0.9729 Pt-ASA1.1,ASA%2C,pseudogene
AT4G27310 CO B-box type zinc finger family ... Potri.011G039700 19.59 0.8195
Potri.003G013856 21.97 0.9709
AT4G10950 SGNH hydrolase-type esterase s... Potri.003G141300 22.84 0.9722
AT2G31690 alpha/beta-Hydrolases superfam... Potri.014G150700 22.97 0.9728

Potri.013G066620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.