Plant FIBer expression Database

Potri.013G070350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001338
[exp]
47 / 4e-07 AT5G17690 240 / 3e-74 TERMINAL FLOWER 2, LIKE HETEROCHROMATIN PROTEIN 1, like heterochromatin protein (LHP1) (.1)
PFAM info
Representative CDS sequence
>Potri.013G070350.1 pacid=42811282 polypeptide=Potri.013G070350.1.p locus=Potri.013G070350 ID=Potri.013G070350.1.v4.1 annot-version=v4.1
ATGGGGCCATCACCAATAGTACCCTCTCTAATGGTGGGAGTCCTGGGTCTGGTCATCTTTGGCCCTATGATAATGGCACTTGCGGATTATATACTGCCAC
TATTTCAAGCAGGTGATGAAGATGTGGCGTTCAACTTCTGGACGGTGTTTCCTCTTTTACTGTTACTGCTCATACACACGATTTCTTCATGCTTTCCCTC
CCGTGGCAGCAGGTATTTTGGTACAAAACAGGGAAGTAGTAGCTCTAGCAATGATGATGGATATGGTTTGGGATCATTACTTCTTCTTGTGCTCTTTTTC
GTCCTGTATAATGTTTGGTAG
AA sequence
>Potri.013G070350.1 pacid=42811282 polypeptide=Potri.013G070350.1.p locus=Potri.013G070350 ID=Potri.013G070350.1.v4.1 annot-version=v4.1
MGPSPIVPSLMVGVLGLVIFGPMIMALADYILPLFQAGDEDVAFNFWTVFPLLLLLLIHTISSCFPSRGSRYFGTKQGSSSSSNDDGYGLGSLLLLVLFF
VLYNVW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.013G070350
[exp]
0 1
AT5G19890 Peroxidase superfamily protein... Potri.003G214500
[exp]
1.41 0.9780 PRX1.10
AT4G20140 GSO1 GASSHO1, Leucine-rich repeat t... Potri.003G156200
[exp]
2.82 0.9665
AT4G00910 Aluminium activated malate tra... Potri.002G174600
[exp]
3.16 0.9711
AT4G01070 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYL... Potri.014G041800
[exp]
4.89 0.9771
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Potri.001G176100
[exp]
5.19 0.9771 2OGox3
AT2G39380 ATEXO70H2 exocyst subunit exo70 family p... Potri.008G048700
[exp]
6.92 0.9653
AT1G31350 KUF1 KAR-UP F-box 1 (.1) Potri.019G044000
[exp]
8.12 0.9548
AT5G53110 RING/U-box superfamily protein... Potri.015G017800
[exp]
8.71 0.9529
AT5G26010 Protein phosphatase 2C family ... Potri.018G059800
[exp]
9.16 0.9630
AT1G16310 Cation efflux family protein (... Potri.010G172700
[exp]
9.94 0.9665

Potri.013G070350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.