Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	TFCFA,Pt-KIS.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30410 183 / 2e-61 TFCA, KIS TUBULIN FOLDING FACTOR A, tubulin folding cofactor A (KIESEL) (.1), tubulin folding cofactor A (KIESEL) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031323 [exp] 162 / 4e-53 AT2G30410 171 / 1e-56 TUBULIN FOLDING FACTOR A, tubulin folding cofactor A (KIESEL) (.1), tubulin folding cofactor A (KIESEL) (.2) Lus10031896 [exp] 160 / 4e-52 AT2G30410 166 / 7e-55 TUBULIN FOLDING FACTOR A, tubulin folding cofactor A (KIESEL) (.1), tubulin folding cofactor A (KIESEL) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02970 [poplar] [flax] TBCA Tubulin binding cofactor A
Representative CDS sequence Show only first row Show all	>Potri.013G071100.1 pacid=42812274 polypeptide=Potri.013G071100.1.p locus=Potri.013G071100 ID=Potri.013G071100.1.v4.1 annot-version=v4.1 ATGGCAAGCAGCAGCCTTAGAAATGCAAAGATCAAGACAAATAGTTGCAAACGAATAGTGAAGGAGCTGCGTTCCTATGAGAAAGAGATTGAGAGAGAAG TTGCTAAAACAGCTGAGATGAAGGACAAAGGAGCTGACCCTTATGACCTTAAGCAACAGGAAAATGTGCTGGCTGAGTCGAGGATGATGATTCCAGATTG TCGTAAACGCCTAGAGGCTGCCTTGGCTGACCTGAAAGCAATTTTGGCTGAATTAGAAGAATCTGATCAGAAGGAAGGCCCAGAAATTGAGGATGCCAGA AACACTATTGCTGAGGTTGAACAGTTGTTTCTAACAACTGATGCTTAG
AA sequence Show only first row Show all	>Potri.013G071100.1 pacid=42812274 polypeptide=Potri.013G071100.1.p locus=Potri.013G071100 ID=Potri.013G071100.1.v4.1 annot-version=v4.1 MASSSLRNAKIKTNSCKRIVKELRSYEKEIEREVAKTAEMKDKGADPYDLKQQENVLAESRMMIPDCRKRLEAALADLKAILAELEESDQKEGPEIEDAR NTIAEVEQLFLTTDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Potri.013G071100 [exp]	0	1	TFCFA,Pt-KIS.1
AT4G14320			Zinc-binding ribosomal protein...		Potri.010G251500 [exp]	2.44	0.8321
AT4G30010			unknown protein		Potri.006G075600 [exp]	6.24	0.8357
AT3G05100			S-adenosyl-L-methionine-depend...		Potri.013G034000 [exp]	6.24	0.8265
AT4G29735			unknown protein		Potri.006G146800 [exp]	8.66	0.7983
AT1G52600			Peptidase S24/S26A/S26B/S26C f...		Potri.003G062800 [exp]	9.94	0.7312
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.010G245400 [exp]	10.19	0.8058	Pt-RPS28.1
AT1G80500			SNARE-like superfamily protein...		Potri.003G183400 [exp]	12.00	0.7959
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Potri.003G069900 [exp]	12.96	0.7640	SEC22.2
AT5G25940			early nodulin-related (.1)		Potri.019G033700 [exp]	13.07	0.7847
AT5G61310			Cytochrome c oxidase subunit V...		Potri.014G120500 [exp]	15.19	0.7774

Compare expression of checked genes

Potri.013G071100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.