Plant FIBer expression Database

Potri.013G074950 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01090 87 / 1e-23 ATCG01090.1, NDHI NADPH dehydrogenases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.013G074950.1 pacid=42811702 polypeptide=Potri.013G074950.1.p locus=Potri.013G074950 ID=Potri.013G074950.1.v4.1 annot-version=v4.1
ATGTTACCTATGGTAACTGGGTTCATGAATTATGGTCAACAAACCATACGGGCTACAAGGTACATTGGTCAAAGTTTCATGACTACCTTATCCCACGTAA
ATCGTTTACCTGTAACTATTGAATATCCTTATGAAAATATTAATCACATCGGAGGGTTTCCGCAGTCAAATCTATTTTGA
AA sequence
>Potri.013G074950.1 pacid=42811702 polypeptide=Potri.013G074950.1.p locus=Potri.013G074950 ID=Potri.013G074950.1.v4.1 annot-version=v4.1
MLPMVTGFMNYGQQTIRATRYIGQSFMTTLSHVNRLPVTIEYPYENINHIGGFPQSNLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01090 ATCG01090.1, ND... NADPH dehydrogenases (.1) Potri.013G074950
[exp]
0 1
ATCG01100 ATCG01100.1, ND... NADH dehydrogenase family prot... Potri.013G074800
[exp]
5.91 0.9643
ATCG01080 ATCG01080.1, ND... NADH:ubiquinone/plastoquinone ... Potri.013G075100
[exp]
8.24 0.9496
AT1G14820 Sec14p-like phosphatidylinosit... Potri.004G046501
[exp]
8.71 0.9233
ATCG00150 ATCG00150.1, AT... ATPase, F0 complex, subunit A ... Potri.013G139080
[exp]
11.83 0.9603
AT5G53486 unknown protein Potri.012G017400
[exp]
15.09 0.8845
ATCG00710 ATCG00710.1, PS... photosystem II reaction center... Potri.019G028200
[exp]
17.32 0.9559
AT1G52140 unknown protein Potri.003G049800
[exp]
20.19 0.8382
ATCG00160 ATCG00160.1, RP... ribosomal protein S2 (.1) Potri.013G139670
[exp]
21.23 0.9537
Potri.013G142972
[exp]
21.90 0.9525
ATCG00160 ATCG00160.1, RP... ribosomal protein S2 (.1) Potri.019G028700
[exp]
22.80 0.9525

Potri.013G074950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.