Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G12190 147 / 4e-43 CYP89A4 Cytochrome P450 superfamily protein (.1) AT1G64940 139 / 4e-40 CYP89A6 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) AT1G64950 138 / 1e-39 CYP89A5 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) AT1G64900 136 / 9e-39 CYP89A2 "cytochrome P450, family 89, subfamily A, polypeptide 2", cytochrome P450, family 89, subfamily A, polypeptide 2 (.1) AT1G64930 130 / 9e-37 CYP89A7 "cytochrome P450, family 87, subfamily A, polypeptide 7", cytochrome P450, family 87, subfamily A, polypeptide 7 (.1) AT5G61320 120 / 4e-33 CYP89A3 "cytochrome P450, family 89, subfamily A, polypeptide 3", cytochrome P450, family 89, subfamily A, polypeptide 3 (.1) AT3G03470 96 / 3e-24 CYP89A9 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) AT1G11600 65 / 5e-13 CYP77B1 "cytochrome P450, family 77, subfamily B, polypeptide 1", cytochrome P450, family 77, subfamily B, polypeptide 1 (.1) AT1G01190 61 / 9e-12 CYP78A8 "cytochrome P450, family 78, subfamily A, polypeptide 8", cytochrome P450, family 78, subfamily A, polypeptide 8 (.1) AT3G53300 56 / 7e-10 CYP71B31 "cytochrome P450, family 71, subfamily B, polypeptide 31", cytochrome P450, family 71, subfamily B, polypeptide 31 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G079600 [exp] 160 / 9e-48 AT1G64940 575 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076700 [exp] 154 / 1e-45 AT1G64940 592 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076600 [exp] 152 / 1e-44 AT1G64940 578 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.007G088018 [exp] 145 / 2e-42 AT1G64940 605 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.007G087950 [exp] 145 / 3e-42 AT1G64950 642 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088154 [exp] 141 / 1e-40 AT1G64950 639 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088086 [exp] 140 / 3e-40 AT1G64950 636 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.015G006100 [exp] 124 / 3e-34 AT1G64940 484 / 7e-168 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.008G099100 [exp] 117 / 6e-32 AT1G64940 540 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002138 [exp] 128 / 1e-35 AT1G64940 586 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10010229 [exp] 117 / 1e-31 AT1G64940 574 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10009536 [exp] 108 / 7e-30 AT1G64940 290 / 1e-95 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020353 [exp] 110 / 3e-29 AT1G64940 572 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10028654 [exp] 105 / 2e-27 AT1G64940 562 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020360 [exp] 103 / 1e-26 AT1G64940 613 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020356 [exp] 99 / 3e-26 AT1G64940 243 / 2e-77 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020359 [exp] 97 / 3e-24 AT1G64940 550 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10013067 [exp] 92 / 1e-22 AT1G64940 472 / 4e-163 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10034156 [exp] 91 / 4e-22 AT5G04660 679 / 0.0 "cytochrome P450, family 77, subfamily A, polypeptide 4", cytochrome P450, family 77, subfamily A, polypeptide 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.013G076501.1 pacid=42811733 polypeptide=Potri.013G076501.1.p locus=Potri.013G076501 ID=Potri.013G076501.1.v4.1 annot-version=v4.1 ATGGCTAAGCCATATCCAGGGCAAATTCTCCTTCAAACTCCGAAAGGCATCATCTTGATCTCCCTGCTTCCTGTTATATCAAATGCTTCCCCTTCACCAT TTAGAAACCTTTCAGGCTTGAAAGCCATGGGATCCTCCCACACCTTTGGATCCCACCCCATATCAGCCACCATGAAATTTACTGTCCCGTTTTTAGGAAT CAGATACCCACCCAACACCGTATCTTCAGTCACAGCATGTGGCAGCACAAAATGCCCAGGTGGGTGTCTCCGTAGACCTTCCAGAATTATTGCTTTTAAA TACGGCATCTTTTGCAGATCATCTTCCTTCACCTCTCCCTCTCCTTATCCAACGACCTCTTTCATTTCCGAAAATAGCTTCTCCTGA
AA sequence Show only first row Show all	>Potri.013G076501.1 pacid=42811733 polypeptide=Potri.013G076501.1.p locus=Potri.013G076501 ID=Potri.013G076501.1.v4.1 annot-version=v4.1 MAKPYPGQILLQTPKGIILISLLPVISNASPSPFRNLSGLKAMGSSHTFGSHPISATMKFTVPFLGIRYPPNTVSSVTACGSTKCPGGCLRRPSRIIAFK YGIFCRSSSFTSPSPYPTTSFISENSFS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.013G076501 [exp]	0	1
AT1G53750		RPT1A	regulatory particle triple-A 1...		Potri.018G056600 [exp]	9.64	0.8786
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.004G157800 [exp]	10.09	0.8817
AT4G17100			unknown protein		Potri.003G085600 [exp]	17.88	0.8363
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Potri.016G112100 [exp]	21.35	0.8602	LAC1b
AT5G63620			GroES-like zinc-binding alcoho...		Potri.004G138700 [exp]	21.90	0.8445
					Potri.016G091300 [exp]	26.00	0.8417
AT4G28556		RIC7	PAK-box/P21-Rho-binding family...		Potri.005G227500 [exp]	27.34	0.7780	Pt-RIC6.1
AT1G65430		ATARI8, ARI8	ARABIDOPSIS ARIADNE 8, ARIADNE...		Potri.001G214201 [exp]	28.14	0.8463
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Potri.004G119400 [exp]	29.69	0.8349
AT3G61230	LIM	PLIM2c	PLIM2c, GATA type zinc finger ...		Potri.003G124300 [exp]	33.19	0.8204

Compare expression of checked genes

Potri.013G076501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.