Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16650 197 / 7e-67 Chaperone DnaJ-domain superfamily protein (.1) AT2G33735 100 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1) AT4G28480 73 / 3e-16 DNAJ heat shock family protein (.1.2) AT3G08910 73 / 3e-16 DNAJ heat shock family protein (.1) AT5G01390 72 / 3e-16 DNAJ heat shock family protein (.1.2.3.4) AT2G20560 70 / 3e-15 DNAJ heat shock family protein (.1) AT3G62600 70 / 4e-15 ATERDJ3B DNAJ heat shock family protein (.1) AT1G77020 68 / 3e-14 DNAJ heat shock N-terminal domain-containing protein (.1) AT1G59725 67 / 5e-14 DNAJ heat shock family protein (.1) AT1G56300 64 / 6e-14 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G041400 [exp] 221 / 3e-76 AT5G16650 193 / 5e-65 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G103900 [exp] 135 / 7e-42 AT2G33735 147 / 2e-46 Chaperone DnaJ-domain superfamily protein (.1) Potri.018G034600 [exp] 73 / 2e-16 AT5G25530 410 / 8e-144 DNAJ heat shock family protein (.1) Potri.007G136700 [exp] 73 / 3e-16 AT2G20560 416 / 5e-146 DNAJ heat shock family protein (.1) Potri.006G246700 [exp] 72 / 5e-16 AT5G25530 394 / 1e-137 DNAJ heat shock family protein (.1) Potri.008G123200 [exp] 72 / 1e-15 AT1G68370 670 / 0.0 ALTERED RESPONSE TO GRAVITY 1, Chaperone DnaJ-domain superfamily protein (.1) Potri.017G016100 [exp] 72 / 1e-15 AT2G20560 420 / 7e-148 DNAJ heat shock family protein (.1) Potri.011G057601 [exp] 71 / 2e-15 AT2G20560 444 / 2e-157 DNAJ heat shock family protein (.1) Potri.014G122600 [exp] 71 / 2e-15 AT3G62600 565 / 0.0 DNAJ heat shock family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014901 [exp] 76 / 7e-19 AT2G33735 85 / 2e-22 Chaperone DnaJ-domain superfamily protein (.1) Lus10040535 [exp] 76 / 1e-18 AT2G33735 84 / 1e-21 Chaperone DnaJ-domain superfamily protein (.1) Lus10027803 [exp] 74 / 1e-16 AT3G08910 504 / 0.0 DNAJ heat shock family protein (.1) Lus10005033 [exp] 74 / 1e-16 AT3G08910 503 / 0.0 DNAJ heat shock family protein (.1) Lus10029862 [exp] 71 / 4e-16 AT1G56300 201 / 9e-67 Chaperone DnaJ-domain superfamily protein (.1) Lus10013981 [exp] 73 / 5e-16 AT2G20560 488 / 8e-175 DNAJ heat shock family protein (.1) Lus10020685 [exp] 70 / 9e-16 AT1G56300 200 / 1e-66 Chaperone DnaJ-domain superfamily protein (.1) Lus10017687 [exp] 71 / 1e-15 AT2G20560 551 / 0.0 DNAJ heat shock family protein (.1) Lus10021961 [exp] 70 / 4e-15 AT5G25530 468 / 7e-167 DNAJ heat shock family protein (.1) Lus10015402 [exp] 70 / 5e-15 AT2G20560 483 / 7e-173 DNAJ heat shock family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF00226 [poplar] [flax] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Potri.013G078200.1 pacid=42812236 polypeptide=Potri.013G078200.1.p locus=Potri.013G078200 ID=Potri.013G078200.1.v4.1 annot-version=v4.1 ATGGAAGACAATGAAAACACCACTCAAAAGGATTACTACAAAATTTTGGAGGTTGATTATGATGCAACAGACGAGAAGATAAGATTAAATTACCGAATGC TTGCACTGAAGTGGCATCCTGATAAGCACCTGGGTGATAGTGCAGTTACCGCCAAATTTCAAGATATCAATGAAGCTTATAAAGTGTTGAGTGATCCAGC TAAACGATTTGAATATGATTTAACTGGAGTATATGAGATTGATAAGTATACTGTGCGGGAATATCTTGCCAGATTTAAAGGAATGATACTTACGTGCAAT GGGCTTGGTATCAGTAATACATCAACATGGACCCAGCAACTGACTGAAACCAAAGACTTGGCAGAAAAATAG
AA sequence Show only first row Show all	>Potri.013G078200.1 pacid=42812236 polypeptide=Potri.013G078200.1.p locus=Potri.013G078200 ID=Potri.013G078200.1.v4.1 annot-version=v4.1 MEDNENTTQKDYYKILEVDYDATDEKIRLNYRMLALKWHPDKHLGDSAVTAKFQDINEAYKVLSDPAKRFEYDLTGVYEIDKYTVREYLARFKGMILTCN GLGISNTSTWTQQLTETKDLAEK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G16650			Chaperone DnaJ-domain superfam...		Potri.013G078200 [exp]	0	1
					Potri.011G144433 [exp]	2.44	0.8107
AT5G64390		HEN4	HUA ENHANCER 4, RNA-binding KH...		Potri.007G116300 [exp]	5.29	0.8529
AT5G15880			unknown protein		Potri.004G105400 [exp]	5.29	0.8346
AT5G45660			unknown protein		Potri.011G076600 [exp]	5.47	0.8458
AT1G19350	BZR	BZR2, BES1	BRASSINAZOLE-RESISTANT 2, BRI1...		Potri.016G125700 [exp]	7.93	0.8104
AT5G15880			unknown protein		Potri.017G110300 [exp]	10.95	0.8007
AT3G11470			4'-phosphopantetheinyl transfe...		Potri.010G238500 [exp]	10.95	0.8227
AT1G75060			unknown protein		Potri.003G130100 [exp]	15.36	0.7303
AT4G17150			alpha/beta-Hydrolases superfam...		Potri.016G001000 [exp]	23.91	0.7642
AT4G18060			SH3 domain-containing protein ...		Potri.011G077500 [exp]	25.63	0.7913

Compare expression of checked genes

Potri.013G078200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.