Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	NAC152
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10480 98 / 6e-23 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT5G46590 96 / 6e-23 NAC ANAC096 NAC domain containing protein 96 (.1) AT3G17730 95 / 7e-23 NAC ANAC057 NAC domain containing protein 57 (.1) AT3G10490 94 / 1e-22 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) AT4G17980 94 / 2e-22 NAC ANAC071 NAC domain containing protein 71 (.1) AT5G17260 94 / 1e-21 NAC ANAC086 NAC domain containing protein 86 (.1) AT4G35580 93 / 4e-21 NAC NTL9, CBNAC NAC transcription factor-like 9 (.1.2.3) AT1G33060 93 / 5e-21 NAC ANAC014 NAC 014 (.1.2) AT1G02230 91 / 6e-21 NAC ANAC004 NAC domain containing protein 4 (.1) AT3G15510 91 / 9e-21 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G099800 [exp] 238 / 6e-77 AT5G24590 103 / 3e-24 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Potri.019G099900 [exp] 184 / 3e-56 AT4G17980 98 / 2e-23 NAC domain containing protein 71 (.1) Potri.002G154200 [exp] 112 / 5e-30 AT4G35580 169 / 5e-50 NAC transcription factor-like 9 (.1.2.3) Potri.002G182000 [exp] 103 / 5e-26 AT4G35580 186 / 9e-56 NAC transcription factor-like 9 (.1.2.3) Potri.014G107500 [exp] 105 / 1e-25 AT4G35580 143 / 3e-37 NAC transcription factor-like 9 (.1.2.3) Potri.002G182300 [exp] 101 / 2e-25 AT4G35580 184 / 4e-55 NAC transcription factor-like 9 (.1.2.3) Potri.002G181800 [exp] 101 / 3e-24 AT4G01550 138 / 1e-35 NAC with Transmembrane Motif 2, NAC domain containing protein 69 (.1.2) Potri.012G007500 [exp] 100 / 2e-23 AT5G24590 306 / 4e-98 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Potri.015G004100 [exp] 99 / 2e-23 AT3G49530 309 / 5e-99 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030174 [exp] 100 / 1e-24 AT4G35580 152 / 5e-43 NAC transcription factor-like 9 (.1.2.3) Lus10005144 [exp] 96 / 2e-23 AT4G35580 142 / 3e-39 NAC transcription factor-like 9 (.1.2.3) Lus10035373 [exp] 96 / 1e-22 AT4G17980 280 / 2e-93 NAC domain containing protein 71 (.1) Lus10007377 [exp] 97 / 2e-22 AT1G65910 431 / 7e-143 NAC domain containing protein 28 (.1) Lus10010148 [exp] 97 / 2e-22 AT4G35580 325 / 9e-105 NAC transcription factor-like 9 (.1.2.3) Lus10030978 [exp] 95 / 2e-22 AT4G17980 273 / 6e-91 NAC domain containing protein 71 (.1) Lus10042284 [exp] 94 / 3e-22 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10020794 [exp] 96 / 4e-22 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2) Lus10026373 [exp] 94 / 4e-22 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10042518 [exp] 96 / 5e-22 AT5G22290 113 / 1e-27 fructose-sensing quantitative trait locus 6, NAC domain containing protein 89 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.013G079700.1 pacid=42811349 polypeptide=Potri.013G079700.1.p locus=Potri.013G079700 ID=Potri.013G079700.1.v4.1 annot-version=v4.1 ATGACAAGCAAGGCAACATGTTTAGCATCTGACGTTGGAGATAGATTTAGTCCGAATAATGAAGAAATAATAAATCATTTTCTAAGGCACAAGTTACTTG GAAATGATCACCTAGTCAGCAAAATCCCCCAGCTTGATATCTACCAGTTTGATCCTTGGGATTTACCCTGGATAAATTCAAAAGATCGAGAAGGGTATTT CTTTTCTCCTCTCCATGCTAAGAACTCCTACACAAATAACGGGAGAATCAATAGGTCAACAAATACAGGTTCATGGCAAGCTAAAGGAAGGGATTGTAAA GTAACATCTGAACTTAATGGGGAAGTAATTGGTATAAAAAAGATTTTTGTTCATTCCTGTATCAAGGATGGAATCAAGTATGTGATGCACGAGTTCAGTG CAAGTTTCAATTTACCTAATTGCCGGGACCTGAGGGCTCTGGTTCTCTGTAAAGTAATGATGAAGACGCTAGACAAGAAGACTGAAGGATCATATATGAA GGTTAAAGAGACAGAGGAGGAGGCTAGTAGTCCTCCAGCATCTGATGAAGATCAGCAGACTGACAATTTAATCTGTGATGATGGTGGAACAAATTGCTTA GCAGCTTCTGCTTCTGCGAACCATGCTGTAGAATTTACAATTCCAGAAGAGGTGGACCTTGAAATACCACCACATCTGCAATTGTTCCCCGGTTATGATC AGCAGGATTATAACCATGGATTCATATTTTATGACCAGCCACTGATTCTTACAGGGCAACTACACGCTGACAATGGCCCAGGAACTTCCAGTACTGAGGA AGATATGTTCAACGGGTTCGGATCTCTCTGGGATTGA
AA sequence Show only first row Show all	>Potri.013G079700.1 pacid=42811349 polypeptide=Potri.013G079700.1.p locus=Potri.013G079700 ID=Potri.013G079700.1.v4.1 annot-version=v4.1 MTSKATCLASDVGDRFSPNNEEIINHFLRHKLLGNDHLVSKIPQLDIYQFDPWDLPWINSKDREGYFFSPLHAKNSYTNNGRINRSTNTGSWQAKGRDCK VTSELNGEVIGIKKIFVHSCIKDGIKYVMHEFSASFNLPNCRDLRALVLCKVMMKTLDKKTEGSYMKVKETEEEASSPPASDEDQQTDNLICDDGGTNCL AASASANHAVEFTIPEEVDLEIPPHLQLFPGYDQQDYNHGFIFYDQPLILTGQLHADNGPGTSSTEEDMFNGFGSLWD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Potri.013G079700 [exp]	0	1	NAC152
AT5G19860			Protein of unknown function, D...		Potri.003G217200 [exp]	5.09	0.7916
AT3G13570		SCL30A, At-SCL3...	SC35-like splicing factor 30A ...		Potri.016G062500 [exp]	8.06	0.7629
AT1G07400			HSP20-like chaperones superfam...		Potri.018G140600 [exp]	8.30	0.7878	Pt-HSP17.2
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Potri.001G151800 [exp]	11.53	0.7520	ATBI.1
AT5G66360		DIM1B	adenosine dimethyl transferase...		Potri.006G264101 [exp]	14.28	0.7792
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.002G184900 [exp]	32.04	0.7429	GLP10.1
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Potri.005G184400 [exp]	35.91	0.7464	GA20ox3
AT2G25355			PNAS-3 related (.1.2)		Potri.015G075400 [exp]	42.21	0.7233
AT2G03890		UBDKGAMMA7, ATP...	UBIQUITIN-LIKE DOMAIN KINASE G...		Potri.010G137400 [exp]	44.58	0.7123
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.018G013200 [exp]	45.29	0.6769

Compare expression of checked genes

Potri.013G079700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.